WWW.DISS.SELUK.RU

БЕСПЛАТНАЯ ЭЛЕКТРОННАЯ БИБЛИОТЕКА
(Авторефераты, диссертации, методички, учебные программы, монографии)

 

Pages:     | 1 || 3 | 4 |

«ХАРАКТЕРИСТИКИ СТРУКТУРЫ И СВОЙСТВА БЕЛКОВ СИСТЕМ ИНФИЦИРОВАНИЯ БАКТЕРИОФАГОВ Т4 И PHIKZ И НЕКОТОРЫХ МЕМБРАННЫХ БЕЛКОВ ...»

-- [ Страница 2 ] --

Ферменты. В работе использовались рестриктирующие эндонуклеазы NcoI, BamHI, HindIII, XhoI, BglII и ДНК лигаза фага Т4 фирмы Fermentas (Литва), ДНК полимераза Thermophilus aquaticus (Taq – полимераза) фирмы New England Biolabs (США).

рекомендациям фирм-изготовителей с использованием прилагаемых буферов.

Олигонуклеотиды для проведения ПЦР.

Прямой праймер (g35-FOR): 5’- ggt acc atg gaa att tat gg - 3’ Обратный праймер (g35-REV): 5’- gaa gga tcc cta aat tta aac ttc - 3’ Прямой праймер (g181M-FOR): 5’ – aga gga tcc gct caa gct aca – 3’ Прямой праймер (g181E-FOR): 5’ – tat gga tcc atg gag aat aag – 3’ Обратный праймер (g181-REV): 5’ - tat aag ctt acc aag tga ttg act att – 3’ ампициллин, фенол, хлороформ, IPTG, бромистый этидий фирмы Sigma (США), бакто-триптон, дрожжевой экстракт фирмы Difco (США), SDS (Serva, Германия), Coomassie R (Sigma, США), уксусную кислоту (Реахим, Россия), Tris-НСl (Sigma, США), EDTA (Serva, Германия), лизоцим (Serva, Германия). Растворы приготавливались с использованием воды Milli-Q, полученной на установке Millipore (США).

2.2 Материалы, использованные в эксперименте по исследованию бактериородопсина и его делеционных мутантов (штаммы, Штаммы бактериальных культур. Для экспрессии гена bO (и его делеционных мутантов), выделенного из плазмиды pUCBM20 [167] и клонированного в плазмидный вектор NTS1-1233 [168, 169] с lac промотора, использовали различные штаммы E. coli – DH5, ER2507, BL21(DE3), BL21Star, BL21(DE3)(pLysS) (New England Biolabs GmbH (NEB), Германия).

Для наработки плазмидных конструкций со вставкой гена bO и его делеционных мутантов были использованы штаммы E. coli XL10-Gold (Stratagene, США) и Top10 (Invitrogen, США).

Среды для выращивания бактерий. Использовали ряд жидких питательных сред:

1) 2хTY - 16 г триптона (AppliChem GmbH, Германия), 10 г дрожжевого экстракта (AppliChem GmbH, Германия) и 5 г NaCl (AppliChem GmbH, Германия) на 1 л воды;

2) LB - 10 г триптона (AppliChem GmbH, Германия), 5 г дрожжевого экстракта (AppliChem GmbH, Германия) и 10 г NaCl (AppliChem GmbH, Германия) на 1 л воды;

3) TB - 12 г триптона (AppliChem GmbH, Германия), 24 г дрожжевого экстракта (AppliChem GmbH, Германия), 5 г глицерола (MP Biomedicals LCC, Франция), 16.43 г K2HPO43H2O (AppliChem GmbH, Германия), KH2PO (AppliChem GmbH, Германия) на 1 л воды;

4) SOC - 2% триптон (AppliChem GmbH, Германия), 0.5% дрожжевой экстракт (AppliChem GmbH, Германия), 10 mM NaCl (AppliChem GmbH, Германия), 2.5 mM KCl (AppliChem GmbH, Германия), 10 mM MgCl (AppliChem GmbH, Германия), 10 mM MgSO4 (AppliChem GmbH, Германия), 20 mM глюкоза (Sigma-Aldrich, Германия).

В качестве твердой питательной среды использовали LB среду, содержащую 1,5% агара (MP Biomedicals LCC, Франция). Все среды стерилизовали автоклавированием.

Векторы для клонирования, плазмиды. Векторы для клонирования и экспрессии pUCBM20 [167] и NTS1-1233 [168, 169]. Плазмида pUCBM была любезно предоставлена нашей лаборатории профессором, доктором М.

Энгельхардом (Prof. Dr. M. Engelhard, Max-Planck Institute of Molecular Physiology, Otto-Hahn-Str. 11, 44227 Dortmund, Germany), а плазмида NTS1доктором Р. Гриссхаммером (Dr. R. Grisshammer, Membrane Protein Structure Function Unit, National Institute of Neurological Disorders and Stroke, National Institutes of Health, Department of Health and Human Services, Rockville, MD 20852, USA).

Плазмида pUCBM20 (3525 п.н.) является плазмидой для cell-free экспрессии и имеет в качестве вставки ген bO без лидерного пептида и Asp 249 на С-конце.

Плазмида NTS1-1233 (8600 п.н.) имеет His-tag или “гистидиновый хвост”, состоящий из десяти остатков His, наличие которых призвано облегчить процесс очистки белка с помощью аффинной никель-хелатной нейротензиновый рецептор (NTR), к N-концу которого присоедин белок MBP (42 кДа), а к C-концу - бактериальный белок тиоредоксин А (TrxA, 12 кДа), который призван стабилизировать конструкцию и увеличить уровни экспрессии и очистки.

Ниже приведен список из трех запланированных для получения в процессе исследований плазмид с фрагментами ДНК. Все теоретические разработки плазмид были сделаны с помощью программы APE_Plasmid Editor. В качестве вектора использовалась плазмида NTS1-1233 (сокращенно v.1233), порезанная по сайтам NcoI-HindIII, вставка состояла из трех фрагментов ДНК.

1) pl_bOWT v.1233/NcoI-HindIII со вставкой по сайтам NcoI-HindIII, вставка NA-bOWT-fr.1233: фрагмент NA (219 п.н.), ген bOWT (744 п.н.), fr.1233 (450 п.н.).

2) pl_bO10 v.1233/NcoI-HindIII со вставкой по сайтам NcoI-HindIII, вставка NE-bO10-fr.1233: фрагмент NE (223 п.н.), ген bO10 (702 п.н.), fr.1233 (450 п.н.).

3) pl_bO13 v.1233/NcoI-HindIII со вставкой по сайтам NcoI-HindIII, вставка NE-bO13-fr.1233: фрагмент NE (223 п.н.), ген bO13 (693 п.н.), fr.1233 (450 п.н.).

последовательности в плазмиде NTS1-1233, кодирующими часть MBP и сайт узнавания TEV-протеазой, но при удалении гена, кодирующего NTR, с помощью рестрикции, эти участки вырезаются из последовательности. Из-за трудностей, возникших у нас при клонировании фрагментов NA и NE обратно в плазмиду v.1233, их синтез был заказан в фирме GenScript (США), где они были заклонированы в плазмиду pUC57.

Ферменты. В работе использовались рестриктирующие эндонуклеазы NcoI, AatII, Eco47III, XmaI, HindIII, SspI, EcoRI, ScaI фирмы Fermentas GmbH (Германия), ДНК полимераза Phusion® Hot Start II High-Fidelity DNA Polymerase (Thermo Fisher Scientific Germany, Finnzymes, Германия), ДНК полимераза Thermophilus aquaticus (Taq – полимераза), ДНК лигаза фага Т4, смесь дезоксинуклеотидтрифосфатов dNTP фирмы NEB GmbH (Германия), щелочная фосфатаза Shrimp Alkaline Phosphatase (SAP) (Fermentas GmbH, Германия).





рекомендациям фирм-изготовителей с использованием прилагаемых буферов.

Олигонуклеотиды для проведения ПЦР.

Прямой праймер (bRWT-FRW, bR10-FRW, bR13-FRW): frwAatIIEco 5' - caccggacgtccggagtggatctggctagcgctcggtacggcgctaatgggac - 3' Обратный праймер (bRWT-REV): revBR712XmaI 5' - tttcccggggctggtcgcggccgcgccgtcg - 3' Обратный праймер (bR10-REV): revBR659EndoXmaI 5' - tttcccgggtttgtcgtcgtcgtcttcggcttcgccgaagatcgcacgac - 3' Обратный праймер (bR13-REV): revBr347FXaXmaI 5' - tttcccgggccgcccttcgatttcgccgaagatcgcacgactgc - 3' Прямой праймер (fr.1233-FRW): frwXma 5' - tttcccggggagaacctgtacttccagtctaacaacaataacaac - 3' Обратный праймер (fr.1233-REV): revHindIII 5' - tgccaagctttctagattattaatggtg - 3' Германия), краситель нуклеиновых кислот в агарозном геле GelRed Nucleic Acid Stain (Biotium, США), маркер молекулярных масс для электрофореза ДНК - GeneRuler 1kb DNA Ladder, маркер молекулярных масс для электрофореза белков - PageRuler Prestained Protein Ladder, гликоген (Fermentas GmbH, Германия), ДНК-азу, лизоцим, IPTG, имидазол, Tris-НСl, Tris-base, EDTA, PEG 6000, глюкозу, глицин, мальтозу (Sigma-Aldrich, Германия), акриламид и ТЕМЕД (Carl Roth GmbH, Германия), NaCl (Merck KGaA, Германия), PMSF, ампициллин, SDS, N-lauroylsarcosine sodium salt (NLS, Sarkosyl), Coomassie R250, DTT (AppliChem GmbH, Германия), ингибитор протеаз Complete (Roche Applied Science, США), TEV-протеазу (Promega, США), детергенты n-Decyl--D-maltopyranoside (DM), n-Dodecyl-D-maltopyranoside (DDM), n-Dodecylphosphocholine (FOS-12), Lauryldimethylamine-N-oxide (LDAO), 3-[(3-cholamidopropyl)dimethylСША), первичные ammonio]-1-propanesulfonate (CHAPS) (Affymetrix, антитела anti-His (Santa Cruz Biotechnology, Inc., Германия) и anti-MBP (NEB GmbH, Германия), вторичные антитела anti-Mouse (Sigma-Aldrich, Германия), субстрат NBT-BCIP для иммуноблоттинга (ThermoScientific Germany, Германия), носитель агарозу Ni-NTA(QIAgen, Германия), носитель amylose resin (амилоза) (NEB GmbH, Германия).

полученной на установке Millipore (США).

2.3 Методы генной инженерии 2.3.1 Методы генной инженерии, использованные в эксперименте по исследованию белков бактериофагов амплифицировали методом полимеразной цепной реакции с использованием многоканального амплификатора ДНК МС-2 (ДНК-технологии, Россия).

Реакционная смесь содержала следующие компоненты (Promega, США):

10буфер для амплификации

MgCl2 (25 mM исх.)

Матричная ДНК (плазмида или ДНК фагов Т4/phiKZ с конц. 100 ng/µl).....2 l Смесь дезоксинуклеотидтрифосфатов (конц.10 mM)

Taq-полимераза

Pr – FOR………………………………………………………………………...3 l Pr – REV………………………………………………………………...…........3 l Вода mQ…

Поверх реакционной смеси наслаивали 25 l минерального масла (Sigma, США) для предотвращения испарения.

Реакцию начинали со стадии предварительной денатурации ДНК при 94оС в течение 3 мин. Затем выполняли 30 циклов амплификации при следующих условиях по температуре и временной продолжительности стадий: 1) 94оС, 1 мин; 2) при соответствующей праймеру температуре отжига Тотж, 1 мин; 3) 720С, 1 мин. По окончанию 30 циклов делали достройку концов при Тдостр =720С в течение 3 мин. Оптимальная температура отжига для данной пары праймеров оказалась Тотж =450С.

Праймеры были синтезированы таким образом, чтобы в них содержались нужные последовательности нуклеотидов (сайты рестрикции), отсутствующие в генах 35 и 181; по этим сайтам в дальнейшем производилась рестрикция.

Очистка амплифицированных фрагментов. Амплифицированные фрагменты ДНК анализировали по подвижности с помощью электрофореза в 1-2% агарозном геле с добавлением бромистого этидия по стандартной методике Маниатиса [170]. Продукты амплификации очищали с помощью набора реактивов QIAquick PCR фирмы QIAgen (Германия) согласно инструкции фирмы изготовителя.

Выделение и очистка плазмидной ДНК. ДНК выделяли из геля и очищали с помощью набора реактивов QIAquick Gel Extraction фирмы QIAgen (Германия) согласно инструкции фирмы изготовителя.

Плазмидную ДНК в аналитических количествах выделяли из 3-10 мл среды с помощью набора реактивов QIAprep Spin фирмы QIAgen (Германия) согласно инструкции фирмы изготовителя.

Рестрикция и лигирование. Рестрикция осуществлялась по сайтам NcoI-BamHI (pl_g35), BamHI-XhoI, BglII-XhoI (pl_g35-36) и BamHI-HindIII (pl_g181M, pl_g181MA и pl_g181E) в буфере R+ (Fermentas, Литва), наиболее подходящем для данных ферментов. Для постановки лигирования использовали вектор, линеаризованный по соответствующим сайтам рестрикции и трехкратный избыток клонируемого фрагмента. Реакцию проводили в объеме 20 µl с использованием Т4-ДНК-лигазы и соответствующего буфера в течение 4 часов при 160С.

Трансформация компетентных клеток E. coli. После реакции лигирования производили трансформацию компетентных клеток лигазной смесью. К 10 l лигазной смеси добавляли 200 l компетентных клеток штамма Top10 E. coli и инкубировали 30 мин во льду. Потом делали тепловой шок при 420С в течение 1.5 мин. Затем реакционную смесь охлаждали во льду 5 мин, добавляли 200 l 2хYT бульона без ампициллина и инкубировали 1 час при 370С. Выросшие клетки высевали на чашки Петри с 2xYT агаром с добавлением 100 g/ml ампициллина. Смесь втирали стерильным шпателем в агаровый слой и инкубировали в течение ночи при 370С.

Селекция клонов клеток Тор10, содержащих рекомбинантные плазмиды. Отбор клонов производился с помощью быстрого скрининга. Как правило, трансформация компетентных клеток Top10 E. coli лигазной смесью давала 15-40 колоний клеток, получивших устойчивость к антибиотику.

Собранные с помощью стерильных зубочисток клоны помещали в стерильные пробирки, содержащие по 200 l среды с ампициллином g/ml, и выращивали в течение 3 часов при 370С. Выросшие клетки центрифугировали 1 мин на 12000 об/мин. Осадок ресуспендировали в 20 l 10 mМ Tris-Cl pH 8,0 и добавляли 20 l смеси фенола и хлороформа (1:1).

Экстракционную смесь перемешивали и центрифугировали 10 мин при об/мин. Водный слой, содержащий плазмидную ДНК, анализировали методом электрофореза в 1% агарозном геле по стандартной методике Маниатиса [170]. Клетки Тор 10, в клонах которых наблюдалось изменение электрофоретической подвижности плазмиды по сравнению с исходным вектором, переносили в 4 ml 2xYT бульона с добавлением ампициллина и инкубировали при 370С в течение ночи с интенсивной аэрацией. Плазмидную ДНК выделяли и очищали с помощью набора реагентов QIAprep по стандартной методике [171]. Выделенную плазмидную ДНК обрабатывали соответствующими рестриктазами и анализировали длину фрагментов с помощью электрофореза в 1% агарозном геле.

Экспрессия клонированных генов в E. coli. Экспрессию гена, клонированного в соответствующий плазмидный вектор и находящегося под контролем промотора фага Т7, осуществляли по методу Стадиера [172].

Компетентные клетки BL21(DE3) трансформировали сконструированной плазмидой, высевали на чашки с агаром, содержащим ампициллин 100 g/ml, и инкубировали при 37оС в течение 12-18 ч. Колонии трансформантов инокулировали в 4 ml среды 2xTY, содержащей ампициллин 200 g/ml, и выращивали при 37оС до плотности А600 0.6 о.е. Для индукции экспрессии добавляли IPTG до конечной концентрации 1 mМ и продолжали инкубацию в течение 3 ч при 37оС. Клетки осаждали центрифугированием при об/мин в течение 5 мин (Мegafuge 2.0 R, Heraeus, Германия). Для препаративной наработки полноразмерных рекомбинантных белков gp35 и gp35-36 объем среды культивирования увеличивали до 500 ml.

Электрофоретический анализ рекомбинантных белков. 30 l культуры клеток после экспрессии смешивали с 10 l 4-кратного буфера для образцов (0.25 М Трис-НСl, pH 6.8, 8% SDS, 40% (об./об.) глицерина, 0.02% (вес/об.) бромфенолового синего), прогревали при 100 оС в течение 3-5 мин и наносили на гель по 10-20 l. Электрофорез в денатурирующих условиях в присутствии SDS проводили в 12% полиакриламидном геле (ПААГ) по методу Лэммли [29]. Гели окрашивали 0.3% Coomassie R в растворе уксусной кислоты/этанола/воды (1:3:6, об./об./об.), отмывали раствором, содержащим 50% этанола и 7% уксусной кислоты. В качестве маркера молекулярных масс использовали стандартную смесь белков (Pharmacia Biotech, Швеция), содержащую -лактальбумин (14.4 кДа), соевый ингибитор трипсина (20. кДа), карбоангидразу (30.0 кДа), овальбумин (43.0 кДа), бычий сывороточный альбумин (БСА) (67.0 кДа), гликогенфосфорилазу (94.0 кДа).

Анализ белков на растворимость. После экспрессии клетки центрифугировали и замораживали при температуре -20оС, а затем ресуспендировали в 4 ml TE-буфера (50 mМ Tris-НСl рН 8.0, 5 mМ EDTA) и лизировали в течение 15 мин при комнатной температуре в присутствии 10 l ультразвуковому разрушению в течение 2-3 мин (разрушение по 15 с, затем перерыв по 15-20 с) на дезинтеграторе UD-20 (Techpan, Польша). Остатки клеточных стенок удаляли центрифугированием при 12000 g в течение мин (J2-21, Beckman, Германия). Супернатант и осадок анализировали в 12% SDS-ПААГ.

Выделение, рефолдинг и очистка gp35. Белок gp35 при экспрессии в системе E. coli BL21(DE3) дает нерастворимые тельца включения. Осадок клеток из 500 ml культуры ресуспендировали в 4 ml мл буфера, содержащего 50 mМ Tris-HCl pH 8.0, 5 mМ EDTA. Клетки разрушали ультразвуком. Затем центрифугировали в течение 10 мин при 15000 об/мин, 4 oC (ротор Sorvall Jдля удаления клеточных стенок. Супернатант удаляли, а осадок снова растворяли в том же буфере. Этот процесс проводился 4 раза и был необходим для очистки gp35 от клеточных белков. Белок, находящийся в промытом осадке телец включения, ресуспендировали в 2 ml 8 М мочевины.

После удаления нерастворившихся частиц центрифугированием, солюбилизированный в мочевине белок наносили на анионообменную колонку (Mono-Q cartridge 5 ml, Pharmacia Biotech, Швеция), предварительно промытую буфером, содержащим 50 mM Tris-HCl pH 8.0, 5 mM EDTA и 8 М мочевину, и элюировали линейным градиентом NaCl от 100 до 600 mМ.

Фракции, имеющие искомый белок (обычно 100 - 200 mМ NaCl), объединяли, добавляли 0.5 mM PMSF и диализовали в буфере, содержащем 50 mM Tris-HCl pH 8.0, 5 mM EDTA. Диализ проводили в течение ночи.

Продукты диализа анализировали в 12% SDS-ПААГ.

2.3.2 Особенности методов генной инженерии, использованных при исследовании белка gp181 бактериофага phiKZ с помощью направленного делеционного мутагенеза Экспрессия клонированных генов в E. coli. Экспрессию генов, клонированных в плазмидный вектор pQE-30 и находящихся под контролем промотора фага Т5, осуществляли по методу Стадиера [172].

трансформировали компетентные клетки AD494(DE3), имеющие геномную устойчивость к канамицину. Затем клетки, трансформированные плазмидами pl_g181M, pl_g181MA и pl_g181E, соответственно, высевали на чашки с агаром, содержащим ампициллин (100 g/ml) и канамицин (50 g/ml).

Чашки с содержимым инкубировали при 37оС в течение 12-18 часов. Затем колонии трансформантов, несущих плазмиды pl_g181M, pl_g181MA и pl_g181E, инокулировали в 150 ml среды 2xTY, содержащей ампициллин (100 g/ml) и канамицин (50 g/ml). Наращивали при 37оС до плотности А600, примерно, равной 0.6 о.е. Для индукции экспрессии добавляли IPTG до конечной концентрации 1 mM и продолжали инкубацию в течение ночи при 18оС. Клетки осаждали центрифугированием при 3000 об/мин в течение мин. Для препаративной наработки полноразмерных рекомбинантных gp181MA и gp181E объем среды культивирования увеличивали до 500 ml.

центрифугирования клетки ресуспендировали в 20 ml буфера (25 mM TrisНСl рН 8.0, 200 mМ NaCl, 10% сахароза, 0.2% Tween 20), добавляли 1 mM PMSF. Детергент Tween 20 и сахарозу использовали для улучшения солюбилизации. Клеточную суспензию обрабатывали в течение 2-3 мин на ультразвуковом дезинтеграторе за несколько циклов: разрушение 15 с, затем перерыв 15-20 с. Остатки клеточных стенок удаляли центрифугированием при 15000 g в течение 15 мин (J2-21, Beckman, Германия). Супернатант и осадок анализировали в 12% SDS-ПААГ.

Очистка белков gp181M, gp181MA и gp181E. После выделения растворимые белки gp181MA и gp181E очищали с помощью аффинной хроматографии на колонке (High-Trap chelating Ni, 5 ml, Pharmacia Biotech, Швеция) при скорости v = 2 ml/min в ступенчатом градиенте имидазола (0mM-200 mM), используя буфер 20 mM Tris-HCl pH 8.0, 200 mM NaCl.

Белок gp181M при экспрессии в системе E. coli AD494(DE3) дает нерастворимые тельца включения. Поэтому белок gp181M, содержащийся в промытом осадке телец включения, ресуспендировали в 10 ml 8 М мочевины (pH 8.1). После удаления нерастворившихся частиц центрифугированием солюбилизированный белок чистили на колонке с носителем Ni-NTA agarose (QIAgen, США), элюируя его натрий-фосфатным буфером в ступенчатом градиенте pH (pH 8.1 - 6.3 - 5.0, 100 mM фосфата натрия, 10 mM Tris HCl, M мочевины). Искомый белок gp181M элюировали мочевиной при pH 5.0.

Затем все белки диализовали в буфере, содержащем 20 mM Tris HCl pH 7.5, 200 mM NaCl, 0.5% Tween 80, 0.1% сахарозу. Диализ проводили в течение ночи. Продукты диализа анализировали в 12% SDS-ПААГ.

штаммами бактерии Pseudomonas aeruginosa. Для этого исследования использовались три штамма – PAO, 1 и 37. К 200 l суспензии клеток добавляли 10 l белка gp181E. Центрифугировали на 11 000 об/мин в течение 6 мин. Супернатант и осадок анализировали в 12% SDS-ПААГ.

Спектры кругового дихроизма для белков gp181E и gp181MA.

Очень важную роль в определении вторичной структуры белков играет метод кругового дихроизма (КД). Он не требует знания общей пространственной структуры белка. Наоборот, структурное исследование белка обычно начинается с получения спектров КД. Метод КД основан на различии в поглощении право- и левополяризованного света в спиралях различной закрученности. Из-за этого различия в поглощении плоскополяризованный свет превращается в эллиптически поляризованный [143]. Для белков gp181E и gp181MA были сняты спектры эллиптичности в ультрафиолетовой области 190-250 нм. Белки gp181E и gp181MA имели концентрацию 1.38 mg/ml и 0. mg/ml, соответственно.

Определение олигомерности белка gp181E гель-фильтрацией.

Препарат очищенного белка gp181E наносили на колонку Superose HR10/30 (Pharmacia Biotech, содержащим Tris-HCl pH 8.0, и элюировали со скоростью 0.5 ml/min.

Предварительно колонку калибровали стандартами белков. По графику зависимости логарифма молекулярной массы белка от объема элюции определяли наблюдаемую молекулярную массу белка gp181E.

2.3.3 Методы генной инженерии, использованные амплифицировали методом полимеразной цепной реакции с использованием многоканального амплификатора ДНК Arktik (ThermoScientific Germany, Германия).

Для проведения ПЦР в случае амплификации генов bOWT, bO10, bO13 реакционная смесь содержала следующие компоненты:

10буфер для амплификации

MgCl2 (25 mM исх.)

Матричная ДНК (плазмида pUCBM20/EcoRI с конц. 131.8 ng/µl)................1 l Смесь дезоксинуклеотидтрифосфатов (конц.10 mM)

Taq-полимераза

Pr - FOR (bRWT-FRW, bR10-FRW, bR13-FRW)

Pr - REV (bRWT-REV, bR10-REV, bR13-REV)

Вода mQ…

Для проведения ПЦР в случае амплификации фрагмента fr. реакционная смесь содержала следующие компоненты:

10буфер для амплификации

MgCl2 (25 mM исх.)

Матричная ДНК (плазмида v.1233 с конц. 100 ng/µl)

Смесь дезоксинуклеотидтрифосфатов (конц.10 mM)

Taq-полимераза

Pr - FOR (fr.1233-FRW)……………

Pr - REV (fr.1233-REV)…

Вода mQ…

Для всех четырех фрагментов ДНК был поставлен отрицательный контроль без матрицы.

Реакцию начинали со стадии предварительной денатурации ДНК при 98оС в течение 2 мин. Затем выполняли 35 циклов амплификации при следующих условиях по температуре и временной продолжительности стадий: 1) при 98оС, 15 с; 2) при соответствующей праймеру температуре отжига Тотж, 25 с; 3) при 72оС, 45 с. По окончании 35 циклов производилась достройка концов при Тдостр=72оС в течение 10 мин. Оптимальной температурой отжига для прямой и обратной пары праймеров при амплификации генов bOWT, bO10, bO13 оказалась Тотж=67оС.

При амплификации фрагмента fr.1233 оптимальной температурой отжига для прямой и обратной пары праймеров является Тотж =55оС. Кроме того, в этом случае первая стадия амплификации проводилась в течение 20 с при 98оС. Остальные условия проведения реакции для фрагмента fr. такие же, как и при амплификации генов bOWT, bO10, bO13.

Праймеры были синтезированы таким образом, чтобы в них содержались нужные последовательности нуклеотидов (сайты рестрикции), отсутствующие в генах bOWT, bO10, bO13 и во фрагменте fr.1233; по этим сайтам в дальнейшем производилась рестрикция.

Очистка амплифицированных фрагментов. Амплифицированные фрагменты ДНК анализировали по подвижности с помощью электрофореза в 1-2% агарозном геле с добавлением краски GelRed по стандартной методике Маниатиса [170].

Продукты амплификации очищали с помощью набора реактивов QIAquick PCR Purification Kit фирмы QIAgen (Германия) и набора реактивов GeneClean Turbo Protocols MP Biomedicals (США) согласно инструкциям фирмы-изготовителя.

Выделение и очистка плазмидной ДНК. ДНК выделяли из агарозного геля и очищали с использованием набора реактивов QIAquick Gel Extraction фирмы QIAgen (Германия), набора реактивов GeneClean Turbo Protocols MP Biomedicals (США), набора реактивов NucleoSpin Gel and PCR Clean-up (Macherey-Nagel GmbH & Co, Германия) согласно инструкциям фирмы-изготовителя.

Плазмидную ДНК в аналитических количествах выделяли из 3-10 мл среды с помощью набора реактивов QIAprep Spin Miniprep Kit фирмы QIAgen (Германия) и NucleoSpin Plasmid MiniPrep (Macherey-Nagel GmbH & Co, Германия) согласно инструкциям фирмы-изготовителя. Большее количество плазмидной ДНК выделяли из 25-100 мл среды с использованием набора реактивов QIAgen Plasmid Midi Kit фирмы QIAgen (Германия) согласно инструкции фирмы-изготовителя. Концентрация ДНК после выделения Spectrophotometer for Nucleic Acid and Protein Quantitation (ThermoScientific Germany, Германия).

Переосаждение ДНК с помощью этанола. ДНК переосаждали этанолом в двух случаях: для замены буфера во время проведения рестрикции при использовании рестриктаз, работающих в разных буферах;

перед проведением реакции лигирования вектор и вставка переосаждались вместе для их лучшего перемешивания. Переосаждение проводилось по стандартной методике с использованием компонентов: осадителя гликогена, 3M AcONa (pH=5.2), 100% EtOH и 70% EtOH.

Секвенирование ДНК. Все плазмиды, используемые и полученные в процессе исследований, были секвенированы для определения их нуклеотидной последовательности с помощью специфических праймеров в компаниях Cogenics_Beckman Coulter Genomics (Великобритания) и Eurofins MWG Operon (Германия).

Рестрикция, лигирование, трансформация компетентных клеток E. coli.

После вышеописанной амплификации фрагментов ДНК (bOWT, bO10, bO13, fr.1233), проверки их двухцепочечности с помощью рестрикции по сайту ScaI для bOWT, bO10, bO13 и по сайту EcoRI для fr.1233, они были залигированы в плазмиду pUCBM20, предварительно порезанную по сайту рестрикции SspI, который при разрезании образует тупые концы. Реакции рестрикции проводились в буферах, наиболее подходящих для данных ферментов согласно инструкциям фирмыизготовителя (Fermentas GmbH, Германия).

Клонирование по тупым концам мотивировано следующим образом.

Если проводить реакцию рестрикции амплифицированных фрагментов по введенным в них сайтам узнавания рестриктазами напрямую, а затем анализировать результаты рестрикции с помощью электрофореза в агарозном геле, то не представляется возможным увидеть несколько отрезанных букв в сайтах рестрикции, а значит, нельзя проконтролировать возможное “недорезание” на концах вставок перед лигированием.

Как известно, при проведении реакции лигирования по тупым концам необходимо использовать пятикратный избыток клонируемого фрагмента, т.е. молярное соотношение вектор:вставка=1:5. В данном случае, учитывая длины вектора pUCBM20 и вставок bOWT, bO10, bO13, fr.1233, молярные соотношения вектор:вставка при лигировании были вычислены следующими: 1:1 - для bOWT, bO10, bO13, и 1:0.67 - для fr.1233. Вектор и вставка перед реакцией лигирования были переосаждены вместе для улучшения их перемешивания.

Реакцию проводили в объеме 20 µl с использованием Т4-ДНК-лигазы (NEB GmbH, Германия) и соответствующего буфера с добавлением ATP ( mM, исх.) в течение ночи при 16оС. В случае лигирования по тупым концам в реакционную смесь также был добавлен 15% PEG 6000.

После лигирования лигазную смесь ставили в термостат (65оС, 10 мин) для инактивации фермента лигазы. Перед трансформацией в лигазную смесь был добавлен рестрикционный фермент SspI для того, чтобы уничтожить будущие клоны без вставок, так как у таких клонов не разрушен сайт SspI, а значит, ДНК порежется по нему. Рестрикция проводилась в лигазном буфере, так как буфер для фермента SspI по своему составу мало отличается от лигазного. После рестрикции лигазная смесь снова была переосаждена.

Затем была проведена трансформация компетентных клеток штамма Top10 E. coli лигазной смесью. К 100 l компетентных клеток добавляли l лигазной смеси и инкубировали в течение 30 мин во льду. Потом для клеток создавали тепловой шок при 420С в течение 45 с, после чего реакционную смесь охлаждали во льду 2 мин, добавляли 700 l питательной среды SOC без ампициллина, инкубировали в течение 45 мин при 37 0С, центрифугировали 3 мин на частоте n=3000 об/мин (Eppendorf centrifuge R, США). После центрифугирования большую часть супернатанта сливали, а в оставшемся количестве, примерно, 100 l ресуспензировали осадок клеток, которые высевали на чашки Петри с LB агаром с добавлением 200 g/ml ампициллина. Смесь втирали стерильным шпателем в агаровый слой и инкубировали в течение ночи при 370С.

После того, как на чашках выросли колонии клеток, была проведена селекция клонов клеток Тор10, содержащих рекомбинантные плазмиды. Как правило, трансформация компетентных клеток Top10 E. coli лигазной смесью давала 15-40 колоний клеток, получивших устойчивость к антибиотику.

Выросшие колонии пересевали в стерильные пробирки, содержащие по 3 ml среды с ампициллином 150 g/ml, и выращивали в течение ночи при 37оС с интенсивной аэрацией. После этого клетки центрифугировали в течение мин при n=4000 об/мин (Thermo Scientific Heraeus Megafuge 16 R centrifuge, Германия). Плазмидную ДНК выделяли и очищали с помощью набора реагентов NucleoSpin и QIAprep по стандартной методике [171]. Выделенную плазмидную ДНК обрабатывали соответствующими рестриктазами (bOWT/SspI, SphI; bO10/SphI; bO13/SphI; fr.1233 /XmaI, HindIII) и анализировали длину фрагментов с помощью электрофореза в 2% агарозном геле.

В общей сложности для 4-х фрагментов было проанализировано, примерно, 130 клонов. Для каждого из фрагментов были найдены клоны, содержащие плазмиду со вставкой нужного размера: bOWT_cl.19;

bO10_cl.32, 33, 34; bO13_cl.13; fr.1233_cl.20, 34. Эти плазмидные ДНК последовательностей. Была выявлена на 100% гомология с теоретической последовательностью для клонов bOWT_cl.19; bO10_cl.32, bO13_cl.13.

Для клонов 20 и 34 fr.1233 гомология с теоретической последовательностью составляла 99%.

Плазмида pUCBM20, содержащая вставку, была выделена из 50 ml жидкой культуральной среды (с ампициллином 150 g/ml) с использованием набора реактивов QIAgen Plasmid Midi Kit. Затем была проведена рестрикция плазмиды pUCBM20 по сайтам рестрикции с учетом вставки: bOWT/AatIIXmaI, bO10/Eco47III-XmaI, bO13/Eco47III-XmaI, fr.1233/XmaI-HindIII.

Рестрикция синтезированных фрагментов NA и NE осуществлялась по сайтам NcoI-AatII и NcoI-Eco47III соответственно при выделении их из плазмиды pUC57.

Для постановки окончательного лигирования с тремя вставками использовали вектор v.1233, предварительно выделенный из 50 ml жидкой культуральной среды с помощью набора реактивов QIAgen Plasmid Midi Kit, линеаризованный по сайтам NcoI-HindIII и дефосфорилированный с помощью щелочной фосфатазы SAP (Fermentas GmbH, Германия) для избежания его “залипания” самого на себя.

Создание окончательных конструкций для экспрессии начинали с лигирования двойных фрагментов по липким концам NA-bOWT/AatII-XmaI и по тупым концам NE-bO10/Eco47III-XmaI, NE-bO13/Eco47III-XmaI. При лигировании двух фрагментов друг с другом необходимо, чтобы молярное соотношение между фрагментами было 1:1. Но при этом более длинного фрагмента необходимо брать во столько же раз больше по массе, во сколько раз он длиннее другого. Отбор вставок нужного размера проводили с помощью электрофореза в 1% агарозном геле.

Так как в нуклеотидной последовательности фрагмента fr.1233, клонированного в плазмиду pUCBM20, содержалась ошибка, было принято решение не продолжать анализировать клоны, а сделать лигирование фрагмента fr.1233, полученного с помощью ПЦР, напрямую в вектор v.1233.

Для этого ПЦР-фрагмент fr.1233 был порезан по сайтам рестрикции XmaIHindIII, введенным в него с помощью соответствующих праймеров. Затем были проведены реакции лигирования и трансформации, а также отбор клонов. При проведении лигирования по липким концам необходимо использовать трехкратный избыток клонируемого фрагмента, чему соответствует молярное соотношение вектор:вставка=1:3. Было выявлено искомых клонов, проверенных секвенированием и содержащих в себе плазмидную ДНК v.1233 со вставкой fr.1233.

Окончательным этапом в создании экспрессионных плазмид было лигирование двойных вставок NA-bOWT, NE-bO10, NE-bO13 и вектора v.1233, уже имеющего fr.1233.

Электропорация. Отбор клонов. После реакции лигирования была проведена электропорация компетентных клеток штамма Top10 E. coli с помощью ячеек Bio-Rad (Bio-Rad Laboratories GmbH, Германия). Этот метод более чувствительный, чем обычная трансформация, и позволяет получить большее число колоний. Для каждого из трех видов рекомбинантной плазмиды была произведена селекция клонов с помощью рестрикции и электрофореза в 1% агарозном геле. Выделенные плазмидные ДНК были отсеквенированы для подтверждения их нуклеотидных последовательностей.

Оказалось, что из трех запланированных конструкций (pl_bOWT, pl_bO10, pl_bO13) одна плазмида pl_bOWT содержала нужную вставку ген bOWT. Для двух других конструкций (pl_bO10 и pl_bO13) после электропорации было проанализировано путем секвенирования порядка клонов, но ни в одном из них не было обнаружено нужных вставок.

Экспрессия клонированных генов в E. coli. Экспрессию гена, клонированного в соответствующий плазмидный вектор и находящегося под контролем lac промотора, осуществляли в 5-ти различных штаммах E. coli и в 3-х различных питательных средах 2хTY,TB, LB, указанных выше в разделах Штаммы бактериальных культур и Среды для выращивания бактерий.

Во время экспрессии в разных штаммах каждые три часа проводился отбор образцов из культуральной среды для того, чтобы сделать сравнительный анализ белкового состава клеточных лизатов с целью выявления наиболее подходящего штамма и среды для экспрессии целевого белка. Штамм компетентных клеток E. coli ER2507 и среда 2хTY оказались наиболее благоприятными для экспрессии бактериородопсина. Штамм E. coli ER интересен тем, что он является дефицитным по гену malE.

Компетентные клетки ER2507 трансформировали сконструированной плазмидой, высевали на чашки с LB агаром, содержащим ампициллин ( g/ml), стрептомицин (50 g/ml) и канамицин (15g/ml), и инкубировали при 37оС в течение 12-18 час. Экспрессия белка проводилась в 4.8 л культуральной среды 2xTY, содержащей ампициллин (150 g/ml) и глюкозу (0.2% вес/об., или 0.2 г на 100 мл) в шейкере Infors HT Multitron (Германия).

Для получения предкультуры колонии трансформантов инокулировали в ml среды 2xTY, содержащей ампициллин (150 g/ml) и глюкозу 0.2% (вес/об.), и наращивали при 37оС до плотности А600 1 о.е. Затем предкультура была добавлена к культуральной среде 2xTY с учетом того, что начальная оптическая плотность среды после добавления предкультуры должна быть А600 0.1 о.е. Когда оптическая плотность достигала значения А600 0.8 о.е., производилась индукция экспрессии с помощью IPTG с конечной концентрацией 0.25 mМ. Во время индукции к культуральной среде также был добавлен 50 mM ретиналь, растворенный в 100% EtOH, для того, чтобы ретиналь встроился в бактериоопсин, и бактериородопсин стал функциональным. После этого продолжали инкубацию в течение 16 час при 22оС. Затем клетки осаждали центрифугированием при n=5000 об/мин в течение 30 мин (Beckman Coulter GmbH, Avanti centrifuge J-26 XP, Германия).

Осадок клеток замораживали в жидком азоте и хранили при -80оС.

Электрофоретический анализ рекомбинантных белков. 40 l осадка культуры клеток после экспрессии, промытого 0.5 M NaCl (этот шаг использовался для удаления экзополисахаридов и улучшения клеточного лизиса) и растворенного в воде mQ, смешивали с 10 l 5-кратного буфера для образцов (0.25 М Tris-НСl, pH 6.8, 10% SDS, 50% (об./об.) глицерина, 0.02 % (вес/об.) бромфенолового синего, 0.5 M DTT), замораживали при -80оС и размораживали (повторяли это несколько раз), прогревали при 95оС в течение 5 мин, ставили в лед на несколько секунд. Затем центрифугировали при n=14000 об/мин в течение 10 мин. для осаждения клеточных стенок и полиакриламидном геле (ПААГ) по методу Лэммли [29]. Гели окрашивали в растворе: 0.25% (вес/об.) Coomassie R250, 10% (об./об.) уксусная кислота, 45% (об./об.) MetOH, 45% (об./об.) вода, отмывали раствором, содержащим 7% уксусной кислоты. В качестве маркера молекулярных масс использовали маркер для электрофореза белков - PageRuler Prestained Protein Ladder (Fermentas GmbH, Германия).

Western blot или белковый иммуноблот для определения целевого белка в образце. Для детектирования бактериородопсина в осадке культуры клеток после экспрессии, а также в других случаях, когда необходимо увидеть искомый белок в образце, использовали метод Western blot [173].

Сначала проводили электрофорез в денатурирующих условиях в присутствии SDS в 10% ПААГ. Затем для того, чтобы сделать белки доступными для антител и дальнейшей детекции, осуществляли перенос белков с геля на нитроцеллюлозную мембрану в буфере для переноса (Transfer buffer: 47. mM Tris-base, 38.6 mM глицин, 0.0385% SDS, 20% MetOH, mQ) с помощью камеры для мокрого переноса Mini Trans-blot electrophoretic transfer cell (BioRad Laboratories GmbH, Германия). Для блокирования неспецифичных связываний мембрана после переноса была помещена в блокирующий буфер TBST (20 mM Tris-HCl, pH 8.0, 100 mM NaCl, 5% глицерин, 0.05% Tween20, 0.02% NaN3, 3% обезжиренное сухое молоко, mQ) и выдерживалась при +4оС в течение 12-16 час.

После блокирования разведенные в буфере TBST первичные антитела инкубировали с мембраной и слегка встряхивали на качалке в течение 2-х час при комнатной температуре. Разведение делалось в пропорции 1:1000 для аnti-His (Santa Cruz Biotechnology, Inc., Германия) и в пропорции 1:16000 для anti-MBP (NEB GmbH, несвязавшихся первичных антител буфером TBST. После этого мембрана инкубировалась с разведенными в буфере TBST вторичными антителами в течение 1.5 час при комнатной температуре на качалке. Разведение было сделано в пропорции 1:2000 для anti-Mouse (Sigma-Aldrich, Германия). Затем мембрана отмывалась от несвязавшихся вторичных антител буфером TBST и буфером TBST без молока. Для детектирования белка к отмытой мембране добавляли 8 ml субстрата NBT-BCIP (ThermoScientific Germany, Германия).

Получение клеточных мембран. Осадок клеток, хранившийся при оС, размораживали в воде. Затем ресуспендировали его в лизирующем буфере (Lysis buffer: 50 mM Tris-HCl, pH 8.0, 0.1 M NaCl, 5% glycerol) из расчета 10 ml буфера на каждый грамм клеток (wet weight) и инкубировали с добавлением 0.5 mg/ml лизоцима, ДНКазыI и ингибиторов протеаз (0.5 mM PMSF, Complete). После этого клетки разрушали с помощью пресса (French press, SLM-Aminco Spectronic Instruments, США). Для выделения клеточных мембран из разрушенных клеток использовали ультрацентрифугирование на частоте 45000 об/мин в течение 60 мин при +4оС (Beckman Coulter GmbH, Optima L-90K ultracentrifuge, Германия). Осадки, содержащие клеточные мембраны, гомогенизировали в лизирующем буфере, содержащем 40 mM имидазола.

Солюбилизация (выделение белка из мембраны) и скрининг детергентов. Для солюбилизации мембранных белков используются различные детергенты, которые должны поддерживать стабильность таких используются 1-2% детергенты, в зависимости от их вида и CMC (critical micelle concentration). Был проведен скрининг детергентов для выявления экспрессированного в системе, описанной выше. В процессе скрининга проверялось влияние 7 различных детергентов (DM, DDM, CHAPS, SDS, FOS-12, NLS, LDAO) на солюбилизацию bR.

Для проведения солюбилизации к гомогенизированным клеточным мембранам добавлялись детергенты с концентрацией от 0.2% до 2%.

Суспензия перемешивалась на магнитной мешалке при низкой скорости в ультрацетрифугирование на частоте 45000 об/мин в течение 60 мин при +4оС для отделения несолюбилизировавшихся мембран (Beckman Coulter GmbH, Optima L-90K ultracentrifuge, Германия). На каждом из этапов получения клеточных мембран и солюбилизации были отобраны образцы для проведения электрофореза в SDS-ПААГ и Western blot’а.

Очистка рекомбинатного bO на amylose resin. Бактериоопсин в составе комплекса MBP-bO-TrxA-His10 был очищен с помощью аффинной хроматографии на амилозном носителе (NEB GmbH, Германия). Очистка проводилась в двух вариантах: с выделением клеточных мембран (из мембранной фракции) и без выделения клеточных мембран, т.е. из общего клеточного лизата. Эти варианты различаются по времени проведения ультрацентрифугирования и чистоте получаемого белка. При выделении мембран ультрацентрифугирование проводится сразу после разрушения осуществляется непосредственно из мембран. При очистке из общего клеточного лизата солюбилизации подвергаются все разрушенные клетки, и только после этого проводится ультрацентрифугирование.

В обоих случаях для ресуспендирования клеток перед их разрушением с помощью French press и во время очистки использовался лизирующий буфер Lysis buffer (50 mM Tris-HCl, pH 8.0, 0.1 M NaCl, 1 mM EDTA, 1 mM DTT, 5% glycerol).

разбавлялся лизирующим буфером в 2-2.5 раза, т.к. большая концентрация детергента может помешать связыванию белка с носителем из-за того, что белок окружен детергентной "шубой". Согласно руководству фирмыизготовителя (NEB Manual) 1 ml носителя amylose resin связывает до 3 mg белка.

Белок может быть нанесен на колонку двумя способами: самотеком и в объеме. Первый вариант длительнее, но предпочтительнее второго, так как белок в этом случае связывается с носителем более равномерно (кольцом), занимая вакантные места постепенно. При нанесении в объеме белок распределяется по носителю неравномерно – “размазывается” и при элюировании не сходит одним пиком. Исходя из этого, разбавленный белок наносился на колонку с амилозой, предварительно промытую водой и уравновешенную лизирующим буфером с 0.1-0.2% детергентом, который использовался также в качестве Washing buffer. Белок элюировался лизирующим буфером с 0.1-0.2% детергентом и 10 mM мальтозой. Обычно собиралось 10-20 фракций по 0.4-1 ml каждая. Фракции, содержащие искомый белок (обычно, первые 5-7 фракций), объединяли и концентрировали с помощью центриконов (50 kDa, Millipore, Amicon Ultra, США).

Очистка рекомбинатного bO на Ni-NTA resin. Бактериоопсин в составе комплекса MBP-bO-TrxA-His10 был очищен с помощью аффинной хроматографии на носителе nickel nitrilotriacetic acid (Ni-NTA) (QIAgen, Германия). Основные этапы очистки на носителе Ni-NTA идентичны этапам очистки на амилозе. Но есть ряд важных отличий. Для очистки на Ni-NTA используется лизирующий буфер Lysis buffer (50 mM Tris-HCl, pH 8.0, 0.1 M NaCl, 5% glycerol), в котором отсутствуют компоненты EDTA и DTT, использующиеся при очистке на амилозе, т.к. они разрушают носитель NiNTA. Однако, во время солюбилизации и на всех стадиях очистки в лизирующий буфер добавляется 40 mM имидазола. Количество носителя, необходимое для очистки, определялось в соответствии с руководством фирмы-изготовителя (QIAgen Manual), указывающим, что связывающая емкость Ni-NTA resin составляет 50 mg/ml. Белок элюировался лизирующим буфером с 0.1-0.2% детергентом и 500 mM имидазола. Собиралось 10- фракций по 2 ml каждая. Фракции, содержащие искомый белок (обычно белок начинает элюироваться в 6-7 фракциях), объединяли и концентрировали с помощью центриконов (50 kDa, Millipore, Amicon Ultra, США).

Отрезание аффинных тэгов (tags) от белкового комплекса, содержащего рекомбинантный bO, с помощью TEV-протеазы. После очистки белкового комплекса, содержащего рекомбинантный с использованием аффинной хроматографии на носителях Ni-NTA resin и/или amylose resin необходимо было отделить рекомбинантный бактериоопсин от аффинных тэгов (хвостов), с помощью которых белковый комплекс осаждался на носителях, а именно, His10-tag на С-конце и MBP на N-конце.

Для отрезания тэгов использовалась TEV-протеаза (Promega, США), сайты узнавания которой были закодированы в рекомбинантной плазмиде.

Так как TEV-протеаза чувствительна к некоторым детергентам, а в сильных денатурирующих детергентах, таких как SDS, эта протеаза неактивна, был проведен сравнительный анализ работы TEV-протеазы в 3-х различных детергентах (NLS, DDM, FOS-12), которые лучше других подошли для солюбилизации и процедуры очистки бактериоопсина.

После очистки и концентрирования белка был проведен его диализ против лизирующего буфера, содержащего 0.2% детергента. Это делалось для того, чтобы уменьшить количество детергента и удалить имидазол после очистки на Ni-NTA, т.к. TEV-протеаза не функционирует при высоких концентрациях детергентов 1% и в присутствии имидазола. Диализ проводился в течение ночи при +4оС. После диализа белок концентрировали и обрабатывали TEV-протеазой по протоколу, описанному фирмойизготовителем (Promega, ProTEV Protease General Protocol, США). Реакция проводилась в однократном буфере (1ProTEV Buffer) с добавлением 1 mM DTT в течение ночи при +30оС. Результаты реакции анализировались в 10% SDS-ПААГ.

Измерение концентрации белка. Для того, чтобы определить концентрацию белка, использовался спектрофотометр DU800 UV/Vis Spectrophotometer (Beckman Coulter GmbH, Германия). В контрольной кювете находился буфер, в котором был растворен белок. Измерялись максимумы поглощения белка на длинах волн 280 нм (абсорбционный максимум для ароматических аминокислот) и 558 нм (абсорбционный максимум для бактериородопсина).

Методы компьютерного анализа и биоинформатики, применяемые для теоретического исследования белков 2.4.1 Методы биоинформатики для исследования периодичности расположения аминокислот в фибриллярных белках Последовательности аминокислот некоторых фибриллярных белков могут иметь периодическое строение. Для анализа этой периодичности иногда используют преобразование Фурье математического образа символьной последовательности аминокислот в белке.

Преобразование для символьной последовательности аминокислот в полипептидной цепи может быть выполнено не единственным образом – можно предложить несколько различающихся отдельными деталями способов. Во-первых, по-разному можно выполнить перекодировку (“оцифровку”), т.е. замену буквенной последовательности ее математическим образом – функцией f(x). Последняя может быть выбрана кусочно-гладкой [174, 175], например, представлять в графическом виде последовательность прямоугольных импульсов одинаковой амплитуды и одинаковой (или разной, с учетом размеров элементов полипептидной цепи) ширины, или дискретной функцией F(k) от порядковых номеров k мест, занимаемых элементами последовательности [146, 150]. Во-вторых, выбранную функцию-образ можно представлять в виде ряда или интеграла Фурье с соответственно дискретным или непрерывным спектрами частот [175]. В-третьих, амплитудные коэффициенты гармоник ряда (или интеграла) могут быть действительными или комплексными числами и по-разному пронормированы [146, 150, 174], что, впрочем, никак не влияет на относительную интенсивность гармоник в спектре.

Проведенное нами сравнение различных способов преобразования показало, что оптимальным для анализа периодичностей аминокислотной последовательности белка представляется разложение ее дискретной функции-образа F(k) в ряд Фурье [150]. Такого рода дискретное преобразование Фурье использовалось уже в одной из ранних работ [146] по этой теме.

Алгоритм метода Фурье в применении к последовательности аминокислот белка. Рассмотрим, например, относительно короткую последовательность аминокислот белка gp36:

MADLKVGSTTGGSVIWHQGNFPLNPAGDDVLYKSFKIYSEYNKPQAADN

DFVSKANGGTYASKVTFNAGIQVPYAPNIMSPCGIYGGNGDGATFDKANI

DIVSWYGVGFKSSFGSTGRTVVINTRNGDINTKGVVSAAGQVRSGAAAPIA

ANDLTRKDYVDGAINTVTANANSRVLRSGDTMTGNLTAPNFFSQNPASQP

SHVPRFDQIVIKDSVQDFGYY.

Она состоит из L=221 члена, которые представляют собой чередующиеся аминокислотные остатки, все 20 типов которых можно классифицировать 4мя следующими группами [176]:

1) гидрофобные (сокращенно – gfb): A; F; G; I; L; V; W; Y;

2) гидрофильные с положительным зарядом (сокращенно – gfl “+”): H; K; R;

гидрофильные с отрицательным знаком заряда (сокращенно – gfl “–”): D;

4) все остальные (сокращенно – rem): M; N; P; Q; S; T; C.

При исследовании Фурье-методом периодичности расположения в аминокислотной последовательности белка элементов какой-либо одной (или последовательность надо заменить ее математическим образом – кусочногладкой f(x) или дискретной F(km) функцией от порядковых номеров km мест, занимаемых в цепи M элементами (m=1, 2,…M) интересующей группы, после чего они становятся неразличимы (рисунок 2.1).

Рисунок 2.1 - Кусочно-непрерывная функция f(x) и дискретная функция F(km) – математические образы последовательности аминокислот в белке Предположим, функция f(x) задана на множестве x[0, L], например, в виде где (x) - ступенчатая функция Хевисайда [174]. График функции (2.1) шириной и амплитудой, равными 1, каждый из которых расположен между значениями аргумента km1 и km (рис. 2.1). Функция (2.1) удовлетворяет условиям абсолютной интегрируемости, кусочной гладкости и может быть представлена тригонометрическим рядом Фурье [174, 175] с коэффициентами Такое преобразование функции f(x) характеризуется зависимостью которую называют спектром Фурье, а cn2 – интенсивностью гармоники с частотой n [146]. Для ряда (2.2) набор частот спектра (2.4) – дискретный.

Если доопределить (в соответствии с теорией [175]) функцию f(x) на всей числовой оси x(–, ), положив ее значения равными нулю за пределами отрезка [0, L], то получившуюся таким образом функцию можно представить в виде интеграла Фурье с непрерывным спектром I()=c2()=a2()+b2(), где Интегралу соответствует более подробный непрерывный спектр c2(), в котором пики оказываются более плавными, чем в дискретном. Однако, показать, что в нем при небольших полуцелых значениях n=3/2, 5/2, 7/2… периодичности. Поэтому представление функции f(x) рядом (2.2) лучше и проще, чем интегралом (2.6).

Другой вариант – задать f(x) на дискретном множестве x=k=1, 2,…L (рис. 2.1), например, используя обобщенную -функцию Дирака [174]:

В этом случае вместо интегралов в формулах (2.2) вычисляются суммы что, конечно же, гораздо удобнее, поэтому дискретная функция (2.8) предпочтительнее непрерывной (2.1). Отметим, что дискретную функцию типа (2.8) иногда называют функцией положения [150], она принимает всего 2 значения: f=1 при k=km, и f=0 при остальных k.

аналогичных (2.9), перед знаком суммы используется множитель 1/L вместо 2/L. Соответственно, для правильного восстановления функции f(x) другим должен быть и общий множитель у членов ряда (2.2) или в обратном преобразовании Фурье. Но это непринципиально, т.к. при анализе периодичности в спектрах Фурье сравнивают относительные интенсивности различных спектральных компонент cn2. В этом смысле разложения дискретной функции (2.8) в действительный (2.2) или комплексный ряд Фурье [146, 150] совершенно эквивалентны. Стоит отметить, что дискретные f(k)cn, (k, n=1, 2,...L) [150]. Это обстоятельство рассматривают как преимущество данного способа Фурье-трансформации перед другими при периодичность проявляется особенностями в спектре cn2, например, наличием серии эквидистантных (по переменной n) пиков [150].

преобразования Фурье: ряд (2.2) или интеграл (2.6), для непрерывной (2.1) или дискретной (2.8) функции f(x) наиболее оптимальным представляется дискретное преобразование Фурье по формулам (2.2), (2.9), (2.5).

Статистические характеристики и особенности Фурье-спектров для символьных последовательностей аминокислот в белке. В Фурьеспектрах, полученных любым из вышеуказанных возможных способов, присутствует много пиков разной интенсивности I(n). Возникает вопрос:

как отличить достоверные от случайных?

Он решался путем проведения статистического анализа спектра Фурье для дискретной функции типа (2.8), соответствующей символьной последовательности аминокислот со случайным расположением в ней элементов выделенной группы [146, 150]. В результате было установлено, что среднее значение интенсивностей I=c2 спектральных компонент в Фурье-преобразовании (2.2), (2.9), (2.5) может быть определено по простой формуле Замечание: эта формула отличается от аналогичной формулы, полученной в работе [146], числовым множителем 4, что обусловлено присутствием в формулах (2.9) числового коэффициента 2, которого нет в соответствующих выражениях для an и bn работы [146].

В работе [146] была подробно выведена также и формула для дисперсии 2, т.е. среднего значения квадрата отклонения интенсивности c пиков от ее среднего значения с2. В соответствии с последним замечанием, для Фурье-спектра, определяемого формулами (2.5) и (2.9), формула для дисперсии содержит дополнительный числовой множитель 16:

достоверности пиков в Фурье-спектре аминокислотной последовательности белка, доверительный уровень их интенсивности может быть выбран разным:

IJ =I+J, J=0, 1, 2, 3... Интенсивность пиков в спектре распределена по закону 2, который при больших длинах L последовательности и большом числе M элементов, представляющих в ней исследуемую на периодичность группу аминокислот, стремится к нормальному распределению Гаусса [146, 149]. Поэтому для J=0, 1, 2, 3 вероятность того, что интенсивность пика случайно превысит уровень IJ, составляет, соответственно, 50%, 16%, 2,3% и 0,13% [174], то есть, чем выше уровень доверия J, тем меньше вероятность его случайного превышения каким-либо пиком в Фурье-спектре.

Полученные нами спектры для последовательностей аминокислот фибриллярных белков представлены и проанализированы в главе 3. Здесь же стоит сделать ряд следующих замечаний об особенностях таких спектров.

1) О пиках на кратных частотах. Если на какой-то частоте n=2n/L (периоде Тn=2/n=L/n, n=1, 2,…L) обнаруживается достаточно интенсивный пик I(Тn)I1, то и на кратных ей больших частотах np=pn при p=2, 3, 4… (периодах Tnp=Тn/pTn) также могут быть обнаружены пики I(Тnp), сравнимой с I(Тn) несколько большей или меньшей интенсивности. Это та самая “серия эквидистантных пиков” [150]. При этом все пики в ней порождаются одной и той же периодичностью с основным наибольшим периодом Тn, а пики с меньшими периодами Tnp=Тn/p можно не принимать во внимание.

2) О неточности определения периода. Период Тn=L/n каждой спектральной компоненты определяется с погрешностью Tn=Tn/n(n)=Tn2/L(n), где n=1/2 – половина шага изменения номеров n гармоник, определяющая минимальную полуширину пика Tn на графике спектра I(Tn).

3) О спектрах взаимно дополняющих групп. Спектры Фурье для каждой пары аминокислотных групп, представляющих соответственно M и последовательности, абсолютно одинаковы (принцип взаимности), например, спектр объединенной gfb+gfl-группы (без различения знака заряда в gflгруппе) и спектр объединяющей остальные аминокислоты rem-группы.

4) О симметрии частотного спектра Фурье. Частотный спектр обладает симметрией относительно его середины по оси частот: I(n)= I(Ln) [146, 150].

5) О нормировке спектров. Все приведенные в данной работе спектры нормированы делением интенсивности I(Tn) на ее среднее по спектру значение I так, что средний уровень I0=1=, а другие уровни доверия IJ=J+1, J=1, 2, 3.

2.4.2 Вычислительные методы предсказания вторичной структуры мембранных белков по их аминокислотной Применение метода Фурье для исследования периодичности расположения аминокислот гидрофобной группы в последовательностях значительный интерес вызывает группа интегральных трансмембранных транспортных каналов для различных веществ. Очевидная особенность этих периодической) в расположении гидрофобных аминокислот им органически присуще. Если отмеченная повторяемость периодическая, то она как глобальное свойство и признак вторичной структуры белка может быть выявлена вышеописанным методом с использованием преобразования Фурье для исследования фибриллярных белков [177]. Этот же алгоритм применим к исследованию периодичности различных трансмембранных белков.

В спектре Фурье для последовательности каждого из исследованных мембранных белков проявлялся период, который, согласно данным топологическом домене (TPD). Тогда число NTMD трансмембранных участков (иначе говоря, число альфа-спиралей в цепи) можно приближенно определить по предлагаемой формуле где L вся длина цепи, T главный период последовательности, определенный из ее спектра Фурье для аминокислот гидрофобной группы по пику с максимальной интенсивностью I(T) среди пиков с большими значениями периодов T. Он равен средней длине участков повторения элементов цепи. Вычитание единицы в формуле (2.13) учитывает, что число TPD на единицу больше, чем число TMD.

Новый метод анализа расположения трансмембранных участков белка путем многократного усреднения функции гидрофобности внутри “окна”, перемещаемого вдоль полипептидной цепи. Поскольку TMD состоят в большей степени из гидрофобных аминокислот [151], понятно, что средняя по такому участку величина гидрофобности, задаваемая в последовательности белка некоторой функцией f(k) = HN[i(k)] от номера k аминокислоты в цепи, должна быть выше, чем в примыкающих к нему с обеих сторон гидрофильных TPD. Причем, это локальное свойство совершенно не зависит от периодичности расположения характерных участков TMD и TPD в последовательности аминокислот белка. Здесь i(k) = 1, 2,…20 это номер той из известного ряда 20 аминокислот (табл. 2.1), которая стоит в последовательности белка на месте с номером k.

Впервые эту идею реализовали авторы работы [151], которые использовали усреднение функции f(k) в пределах перемещаемого вдоль последовательности аминокислот сегмента “окна” шириной d = 5, 7, 9, 11, 13 a.о.

положению средней точки сегмента.

Используемая в этом методе шкала гидрофобности HN(i) может быть задана многими способами (таблица 2.1) в зависимости от характеризующей это свойство и физически измеряемой величины [151-155].

В работах [151153] в качестве меры гидрофобности использовали изменение величины свободной энергии боковых групп аминокислот при их переносе из гидрофобной среды в воду. В работах [154, 179] мера (шкала) гидрофобности аминокислот определена в виде функции Н4(i) = 1A/A (табл. 2.1) по величинам площади A0(i) поверхности аминокислотного остатка, доступной для растворителя в стандартном состоянии, и средней площади A(i), доступной в свернутом состоянии белка. В работе [154] установлена корреляция между величиной свободной энергии и площадью поверхности доступной для растворителя.

В данной работе сначала использовали ту же простейшую функцию гидрофобности (2.8), что и в вышеописанном методе преобразования Фурье.

Процедура усреднения функции f(k) по шкале HN(i) отлична от той, которую использовали в работе [151]. В данном исследовании усреднение проводилось не один, а несколько раз по алгоритму где каждое новое усреднение производили над предыдущей функцией по окну большей ширины d = 2n + 1: первое усреднение по 3 элементам, второе – по пяти и т.д. Наилучший результат, на наш взгляд, достигался при n = 4, усреднении по окну шириной d = 9 a.о. (иногда при n = 5, d = 11 a.о.).

2.5 Заключение по главе Таким образом, в данной главе описаны экспериментальные методы генной инженерии, используемые для получения белков, и компьютерные методы исследования их структуры. К первым относятся клонирование генов, экспрессия и очистка белков. Ко вторым – оптимизированный метод Фурье, позволяющий исследовать периодичность аминокислотной последовательности белка, а также впервые предложенный в данной работе новый метод анализа расположения трансмембранных участков белка путем многократного усреднения функции гидрофобности внутри “окна”, перемещаемого вдоль полипептидной цепи.

ГЛАВА 3 РЕЗУЛЬТАТЫ ИССЛЕДОВАНИЙ

И ИХ ОБСУЖДЕНИЕ

3.1 Исследование периодичности расположения аминокислот в фибриллярных белках и литических ферментах бактериофагов Т4 и phiKZ методами биоинформатики Решение структуры фибриллярных белков интересно не только с научной точки зрения, но также и с практической. Фибриллярные белки, выполняющие разнообразные биологические функции, являются одними из наиболее интересных и важных объектов современной молекулярной биологии. Так, вирусные белки фибриллярной природы играют первостепенную роль в процессе инфицирования. Узнавание специфических рецепторов на поверхности клетки-хозяина и адсорбция вируса на мембране происходит именно при помощи фибриллярных адгезинов. Таким образом, исследование функциональных участков этих белков, определение их структуры и механизма взаимодействия с рецепторами клетки представляют интерес для разработки способов борьбы с вирусными инфекциями.

Целью данной части работы было применение описанного в главе оптимального преобразования Фурье для исследования периодичностей фибриллярных белков и литических ферментов бактериофагов Т4 и phiKZ.

Интерпретация рассчитанных Фурье-спектров для фибриллярных белков и анализ их периодичности. На языке программирования Delphi была написана специальная программа, с помощью которой для некоторых белков бактериофага Т4 были получены спектры Фурье несколькими возможными способами из вышеописанных. Их сравнение показало, что количество наиболее интенсивных пиков в спектрах и их положение могут различаться, в них могут быть как общие достаточно интенсивные пики, так и индивидуальные. При этом были подтвержден вывод о том, что наиболее подходящим преобразованием Фурье для анализа периодичности полипептидных цепей является способ с использованием формул (2.5), (2.9).

Этим оптимальным методом Фурье-трансформации аминокислотных последовательностей сначала были исследованы пять (gp34-gp38) из шести белков, участвующих в формировании длинных хвостовых фибрилл бактериофага Т4, а также два других его белка gp5 и gp12 с уже известной целиком или частично структурой [13, 180]. Были получены Фурье-спектры I(n) как для полных последовательностей, так и для их частей, построены соответствующие графики зависимости интенсивности пиков I(Tn), которая пропорциональна вероятности повторения аналогичных элементов цепи c периодом Tn, для гидрофобных (gfb), гидрофильных (gfl) групп аминокислот и объединяющей их gfb+gfl-группы (рисунки 3.1-3.4).

На рисунке 3.1 представлены спектры Фурье, полученные для двух аминокислотных групп белка gp36.

Intensity Рисунок 3.1 - Спектры Фурье для групп гидрофобных (gfb) и гидрофильных (gfl) Очевидно, в спектре gfb-группы на рисунке 3.1 присутствует достаточно интенсивный (II3) пик с относительно малым периодом Т=14.70.515. Как и должно быть, согласно замечанию 1) в п. 2.4.1, тот же пик воспроизводится на кратных частотах: двукратной с периодом Т=7.60.17.5 и трехкратной частоте с периодом Т=5.10.15.

В спектре gfl-группы на рисунке 3.1 также имеется пик с малым периодом Т=15.80.6 (близким к 15), он же воспроизводится на трехкратной частоте с Т5. Кроме того, здесь присутствует другой очень интенсивный и широкий пик с максимумом на относительно большом периоде Т=55. (он же, как видно, воспроизводится на пятикратной частоте с периодом Т11.60.3). Пик с таким же периодом Т=55.3 имеет место и в спектре, полученном для объединенной gfb+gfl-группы гидрофобных и гидрофильных аминокислот. Интересно отметить, что вся последовательность белка gp длиной L=221 делится большим периодом Т=55.25=L/4 на 4 равные части.

На рисунке 3.2 представлены спектры, полученные для белка gp35.

Очевидно, в спектре gfb-группы присутствует спектральная компонента с малым периодом Т=15.30.415, а также пик на двукратной частоте с периодом Т=7.40.1. Такой же пик имеется на рисунке 3.2 в спектре для объединенной gfb+gfl-группы. Кроме того, в обоих спектрах есть пик с большим периодом Т=464. Не исключено, что он и воспроизводится на указанных малых периодах Т=15 и 7.5. Вся последовательность белка gp длиной L=275 делится большим периодом Т=45.7275/6=L/6 на 6 равных частей.

На рисунке 3.3 приведены спектры, рассчитанные для объединенной gfb+gfl-группы аминокислот белка gp38 и для группы гидрофобных аминокислот в C-концевой части белковой последовательности gp5 (с 441 по 552 элементы). В спектре белка gp38 на рисунке 3.3 среди всех имеющихся выделяется очень интенсивный пик с малым периодом Т=9.60.310 и еще один достаточно интенсивный пик с большим периодом Т=45.6466, которым вся последовательность аминокислот данного белка делится на равные части. С учетом погрешности пик с меньшим периодом из двух здесь указанных может рассматриваться как соответствующий пятикратной частоте другого или как самостоятельный.

Intensity Рисунок 3.2 - Спектры Фурье для группы гидрофобных (gfb) аминокислот и объединенной gfb+gfl-группы в белковой последовательности gp периодичность белки gp5 и gp12, структура которых была определена ранее методами рентгеноструктурного анализа и электронной микроскопии STEM [13, 180]. Данные о периодичности, полученные методом преобразования Фурье, хорошо согласуются с экспериментальными. Так, известно, что для Cконцевых частей белков gp5 и gp12 характерны повторы с периодом Т=8.

Аналогичный период был установлен в их Фурье-спектрах, один из которых представлен на рисунке 3.3.

Intensity Рисунок 3.3 - Спектры Фурье для объединенной gfb+gfl-группы аминокислот в белковой последовательности gp38 и для группы гидрофобных аминокислот в C-концевой части белковой последовательности gp аминокислот белка gp34, также полученный лишь для части полипептидной цепи длиной L=280 (с номерами 438-717). Наиболее интенсивными в этом спектре являются 5 пиков с указанными на графике периодами T=40.22.8;

20.10.7; 9.80.2; 5.960.06; 4.910.04. С учетом приведенных погрешностей T и факта существования пиков на кратных частотах, вполне вероятно, что первый пик (с наибольшим по величине периодом) воспроизводится остальными соответственно на 2-х-, 4-х-, 7-ми- и 8-микратной частотах, и эти четыре пика из пяти, выделенных на рисунке 3.4, можно исключить из последующего рассмотрения, отчего анализ спектра заметно упрощается.

аминокислот белка gp34, являющейся самой длинной (L=1289) из исследованных, присутствует тот же, что и в части цепи, основной пик с периодом T=41.70.7, а также и другие воспроизводящие его на кратных частотах пики.

Рисунок 3.4 - Спектр Фурье для группы гидрофобных аминокислот в части белковой последовательности gp34 с номерами элементов с 438 по следующим заключениям.

Аналогичные пики с малым периодом Т15 обнаружены для аминокислот gfb-группы в спектрах сразу нескольких исследованных белков:

gp35, gp36 и gp37, а в некоторых белках (gp35, gp36) и для gfl-групп тоже, что свидетельствует о некоторой общности для всех них такого рода периодичности. Нередко встречаются малые периоды другой величины, например, T=8 в белках gp5 и gp12, Т=9.610 в белке gp38, T=40 в белке gp34. Такого рода периодичность с периодами T из 8-20 аминокислот характерна для элементов вторичной структуры -структур [150].

Большие периоды следования аминокислот объединенной gfb+gflгруппы обнаружены также у нескольких белков: для – Т=45.75=183/4=L/4, gp37 – Т=256.5=1026/4=L/4, gp36 – Т=55.25=221/4=L/4, gp35 – Т=45.83=275/6=L/6, gp34 – T=214.8=1289/6=L/6.

То есть повторяемость фрагментов белковой цепи с относительно большим периодом также оказалось общим свойством для целого ряда исследованных белков. Авторы работы [145] полагают, что такого рода периодичность “может быть связана с доменной организацией аминокислотных последовательностей и укладкой их в белковую “глобулу”, т.е. характеризует третичную структуру белков [150].

В спектрах отдельных белков, например, gp35 все или некоторые пики на малых периодах - Т15; 7.5 - могут быть результатом воспроизводства пика с большим периодом Т45 на (3-х- и 6-ти-) кратных частотах и отражать наличие той же самой периодичности. В противном случае (например, как в белке gp34) аминокислотная последовательность может иметь повторяемость как на больших (T=215), так и на малых (T=40) периодах, что также согласуется с результатами и выводами работы [145].

Выравнивание полипептидных цепей с учетом установленных данных об их периодичности. На основании полученных данных о периодичности фибриллярных белков было проведено выравнивание их аминокислотных последовательностей по выявленным периодам и большим, и малым. Это проводилось с использованием компьютера как по другой специально разработанной нами программе, так иногда и “вручную”.

полипептидных цепей: gp34 - с периодом Т=40, выявленным в спектре на рисунке 3.4, и С-концевой части gp5 - с периодом Т=8, обнаруженным в спектре на рисунке 3.3. Самым темным серым фоном обозначены аминокислоты gfl-группы, промежуточным серым фоном – gfb-группы, самым светлым фоном - остальные, входящие в rem-группу. Можно видеть, что повторяемость с указанными периодами в расположении элементов разных аминокислотных групп в полипептидных цепях действительно имеет место.

Рисунок 3.5 - Результаты выравнивания фрагмента аминокислотной последовательности gp34 с 438 по 717 элементы по периоду Т= Периодически упорядоченное расположение аминокислот в первичной структуре белка схематически можно представить себе в виде достаточно простого зрительного образа – трехмерной “спирали”, точнее, винтовой линии, вроде, обмотки соленоида. Этот образ допускает наличие в нем периодов разной длины одновременно. Например, один виток может представлять малый период, а несколько таких витков, образующих один слой обмотки – большой период. Другими словами, в аминокислотных последовательностях не исключено наличие полипериодичности – повторяемости различных элементов структуры с несколькими разными периодами, о чем свидетельствуют и Фурье-анализ, и результаты, полученные другими методами [145].

Ранее методом STEM в белках gp34 и gp37 были обнаружены некоторые повторяющие участки последовательностей, схожие по составу и порядку следования входящих в них конкретных аминокислот с некоторым общим для них шаблоном [180]. С помощью компьютерного анализа удалось найти новые повторы аналогичных шаблону фрагментов, не выявленные прежде с помощью сравнения по гомологии (рисунок 3.7). Интересно отметить, что в белке gp34 указанные фрагменты повторяются с периодом Т=40, обнаруженным методом преобразования Фурье (рисунок 3.4).

Рисунок 3.6 - Результаты выравнивания фрагмента С-концевой части аминокислотной последовательности gp5 с 441 по 552 элементы по периоду Т= Однако в gp35, gp36 и gp38 именно такие повторяющиеся фрагменты отсутствуют, поэтому можно сделать вывод, что эти белки содержат другие повторяющиеся участки.

Расчет спектра Фурье для белка gp181 бактериофага phiKZ. Как было выше сказано и показано на рисунке 3.3, в спектре Фурье для Сконцевой части литического фермента gp5С (структурного лизоцима бактериофага Т4) были обнаружены повторы с периодом Т=8, образующие уникальный паттерн, показанный на рисунке 3.6. При исследовании этого белка с помощью рентгеноструктурного анализа была выявлена такая же периодичность [13]. Кроме того, в структуре gp5 был обнаружен уникальный мотив – тримерная -спираль, о которой говорилось в литобзоре (п. 1.9. главы 1). Результаты, полученные при исследовании gp5, явились новыми и интересными для фундаментальной и прикладной науки.

Рисунок 3.7 - Выявленные повторяющиеся фрагменты Поэтому в данной части работы представилось интересным и целесообразным исследовать литический фермент gp181 (структурный лизоцим бактериофага phiKZ) и попробовать обнаружить в нем схожую периодичность, а также изучить его структуру для понимания механизма его действия при инфицировании бактериофагом phiKZ клетки. В исследовании применялись как теоретические – преобразование Фурье, так и экспериментальные методы, описанные ранее в главе 2.

На рисунке 3.8. приведен Фурье-спектр для группы гидрофобных аминокислот белка gp181, полученный для С-концевой части полипептидной цепи длиной L=1570.

I1, I3 – уровни интенсивности, вероятность случайного превышения которых составляет 16% и 0.13%, соответственно.

Рисунок 3.8 - Спектр Фурье для группы гидрофобных аминокислот Самым интенсивным в этом спектре является пик с периодом T=7.70.48. Этот результат совпадает с результатом, полученным для gp (рисунок 3.3). Но при выравнивании аминокислотной последовательности по выявленному периоду Т=8 не было найдено паттерна, аналогичного обнаруженному в С-концевой части gp5 бактериофага Т4.

Результаты и выводы исследования периодичности расположения аминокислот в фибриллярных белках и литических ферментах бактериофагов Т4 и phiKZ.

периодичности аминокислотных последовательностей оптимальным является дискретное преобразование Фурье, определяемое соотношениями (2.2), (2.9), (2.5), или аналогичное [146, 150].

2. С использованием этого оптимального Фурье-преобразования удалось подтвердить наличие определенной периодичности в исследованных фибриллярных белках бактериофага Т4. Для ряда белков выявлено чередование аминокислот разных групп с относительно малым периодом Т=15, а для некоторых – с другими периодами: 8, 10, 40.

3. Безусловно, новым результатом явилось обнаружение относительно больших периодов следования аминокислот, которыми вся их последовательность в белке делится на 4 или 6 равных частей.

4. Полученные данные о периодичности позволяют выровнять аминокислотные последовательности с учетом установленных периодов обоих типов, что в сочетании с результатами кристаллографических и электронно-микроскопических экспериментов может быть полезным при установлении для белков бактериофага Т4 элементов вторичной и третичной структуры.

5. Нам удалось подтвердить наличие определенной периодичности в белке gp181 бактериофага phiKZ, а, именно, с тем же периодом Т=8, который был обнаружен в белке gp5 бактериофага Т4.

3.2 Экспериментальное исследование белков систем инфицирования бактериофагов Т4 и phiKZ Для фибриллярных белков бактериофага Т4 прежде всего были получены две запланированные плазмидные конструкции pl_g35 и pl_g35- для экспрессии белков gp35 и gp35-36 в E. coli. Плазмиды были созданы с использованием вектора pET-23d(+) (Novagen, США) и содержали в себе полноразмерные гены g35 (1140 п.н.) и g35-36 (1800 п.н.) бактериофага Т4.

Ген 35 был амплифицирован с помощью ПЦР, в качестве матрицы использовалась ДНК фага Т4. ПЦР - продукт был клонирован в вектор pETd(+) по сайтам NcoI и BamHI (рисунок 3.9а). Плазмидная конструкция, содержащая g35-36, была получена на основе предыдущей (рисунок 3.9б).

Вектор (плазмида pl_g35) и вставка (плазмида pl_g36) были линеаризованы с помощью рестрикции по сайтам BamHI-XhoI и BglII-XhoI соответственно (см. п. 2.3.1). Затем была проведена реакция лигирования. После этого компетентные клетки Top10 и отобрали клоны, содержащие вставку. Этими клонами был трансформирован экспрессионный штамм BL21(DE3) E. coli, содержащий ген РНК-полимеразы Т7.

Рисунок 3.9a - Схема плазмидной конструкции, содержащей g Рисунок 3.9б - Схема плазмидной конструкции, содержащей g35- После экспрессии был проведен анализ рекомбинантных белков на растворимость, который показал, что белок gp35 и комплекс белков gp35- экспрессируются в нерастворимой форме, а именно, в виде телец включения.

Экспрессия проводилась при различных температурах: 37С, 30С, 25С, однако, результат был одним и тем же. На рисунке 3.10 представлены картины электрофореза белков из экстракта клеток в 12% SDS-ПААГ, из которых видно, что белки gp35 и gp36 находятся во фракции осадка.

с, d супернатант и осадок gp35-36, соответственно (экспрессия проводилась при 30С);

e, f супернатант и осадок gp35-36, соответственно (экспрессия проводилась при 37С);

a, b супернатант и осадок gp35, соответственно; g белковый маркер Рисунок 3.10 - Результаты анализа белков на растворимость Был проведен рефолдинг белка gp35, предварительно очищенного на колонке Mono-Q в 8 М мочевине, с целью получения этого белка в неустойчивую конформацию и, вследствие этого, оказался нестабильным. Из рисунка 3.11 видно, что после диализа наряду с основной полосой белка появляется минорная, которая, по-видимому, представляет собой продукт протеолитической деградации.

Исследование белка gp181 бактериофага phiKZ проводилось с помощью направленного делеционного мутагенеза. Ген 181 имеет размер 6726 п.н., а белок gp181, кодируемый этим геном, соответственно, 2242 а.о., вычисленная молекулярная масса белка – 246,6 кДа.

Рисунок 3.11 - Деградация gp35 в процессе рефолдинга (12% SDS-ПААГ) делеционного мутагенеза, мы проанализировали его аминокислотную последовательность с помощью программы BLAST [181] с целью выявить консервативные домены в структуре этого белка. Используя эту программу, (аминокислотные остатки 672-2242) находится домен пептидогликановой гидролазы или лизоцимный домен.

С учетом этих данных, а также данных об одинаковой периодичности в С-концевых частях gp181 и gp5 (т.е. с учетом имеющейся аналогии этих белков), были получены три делеционных мутанта гена 181, а именно: ген g181MA (582 п.н.), кодирующий лизоцимный домен, ген g181E (603 п.н.), кодирующий С-концевую часть белка gp181, расположенную после лизоцимного домена и ген g181M, являющийся объединением генов g181MA и g181E (рисунок 3.12).

Были созданы три плазмидные конструкции с использованием вектора pQE-30 E. coli (рисунок 3.13), содержащие гены g181M, g181MA и g181E бактериофага phiKZ, соответственно, pl_g181M, pl_g181MA и pl_g181E.

Гены были амплифицированы с помощью ПЦР, в качестве матрицы использовалась ДНК фага phiKZ. ПЦР-продукты были клонированы в вектор pQE-30 по сайтам BamHI и HindIII (рисунок 3.14).

Стрелки указывают направление транскрипции Рисунок 3.12 - Делеционные мутанты гена g Рисунок 3.13 - Вектор pQE-30 E.coli Вектор и вставка были линеаризованы с помощью рестрикции по сайтам BamHI и HindIII, соответственно (п. 2.3.1, глава 2). Затем была проведена реакция лигирования.

После лигирования полученными плазмидными конструкциями содержащие вставку. Клонами со вставкой g181M, g181MA и g181E был трансформирован экспрессионный штамм AD494(DE3) E. сoli, содержащий ген РНК- полимеразы Т5.

После экспрессии был проведен анализ рекомбинантных белков на растворимость, который показал, что при температуре 37С белок gp181M экспрессируется полностью в нерастворимой форме, белок gp181E частично находится в супернатанте, а белок gp181MA полностью растворим. При проведении экспрессии при пониженной температуре 18С белок gp181M также экспрессировался в нерастворимой форме, однако доля белка gp181E, экспрессировавшегося в растворимой форме, существенно повысилась.

На рисунке 3.15 представлены картины электрофореза белков из экстракта клеток в 12% SDS-ПААГ, из которых видно, что gp181M находится во фракции осадка, а gp181E во фракции супернатанта.

Известно, что белки, которые экспрессируются в виде телец включения, можно перевести в растворимую форму с помощью рефолдинга.

Поэтому был проведен рефолдинг белка gp181M, предварительно очищенного в денатурирующих условиях с целью получения этого белка в растворимой форме. Белок gp181M диализовали в буфере, содержащем mM Tris HCl pH 7.5, 200 mM NaCl, 0.5% Tween 80, 0.1% сахарозу. После диализа, проведенного в течение ночи против использованного буфера, продукт рефолдинга gp181M оказался нерастворимым.

a осадок белка gp181M, c супернатант белка gp181E, b белковый маркер.

Белки gp181MA и gp181E диализовали для того, чтобы избавиться от избытка имидазола в буфере. Так как диализ белков gp181MA и gp181E прошел успешно, было проведено их концентрирование с помощью концентратора Centricon10 (Amicon, США). Для этого белковые растворы были центрифугированы на 3000 об/мин в течение 15 минут 4 раза. При этом белки сконцентрировались в 2.5 раза.

На рисунке 3.16 представлена картина электрофореза белков в 12% SDS-ПААГ до концентрации и после концентрации.

Белки gp181E и gp181MA имеют расчетный молекулярный вес 21.3 кДа и 21.4 кДа, соответственно. Но из рисунка видно, что их подвижность в SDSПААГ соответствует молекулярному весу порядка 30 кДа. Это можно объяснить устойчивостью этих белков к SDS и тем, что они не являются мономерами.

a, b gp181MA до и после концентрирования, соответственно;

c, d gp181E до и после концентрирования, соответственно; e белковый маркер.

После концентрирования также был проведен анализ взаимодействия белков с различными штаммами бактерии Pseudomonas aeruginosa. Белок gp181MA, являясь цитолитическим ферментом, а именно пептидогликановой гидролазой, лизирует клетки. Белок gp181E взаимодействует со всеми тремя штаммами бактерии, но не лизирует их.

На рисунке 3.17 представлена картина электрофореза в 12% SDSПААГ.

a, c – супернатант gp181E +РАО и E.coli, соответственно; e – супернатант РАО, g – супернатант gp181E; b, d – осадок gp181E +РАО и E.coli, соответственно;

Рисунок 3.17 - Взаимодействие gp181E со штаммом РАО Pseudomonas aeruginosa Белок gp181E находится во фракции осадка при взаимодействии со штаммом РАО Pseudomonas aeruginosa. В качестве контроля использовали бактерию E. сoli. При добавлении gp181E к E. сoli взаимодействия не наблюдается – на рисунке 3.17 видно, что белок gp181E полностью во фракции супернатанта.

Перед началом экспериментальных исследований белка gp181E предполагалось, что его С-концевая часть (gp181E) может играть роль наблюдавшимся взаимодействием gp181E с клетками Pseudomonas aeruginosa.

Для белков gp181E и gp181MA были также сняты КД-спектры. Они представлены на рисунках 3.18 и 3.19, соответственно.

Для оценки вкладов вторичных структур (-спиралей, - и неупорядоченных структур) использовано программное обеспечение CDPro (Colorado State University, Fort Collins, CO), алгоритм CONTINLL с набором базисных белков IBasis7 [SDP48] ( = 240 - 190 nm). Обработка спектров показала, что эти белки в основном состоят из -спиралей: gp181E – на 71.5% и gp181MA – на 68%.

Результаты и выводы эксперимента по исследованию фибриллярных белков gp35 и gp36, продукта гена 181 бактериофага phiKZ и его делеционных мутантов.

1. Был создан плазмидный вектор для экспрессии белка gp35 в клетках E. coli и получена плазмидная конструкция для коэкспрессии белкового комплекса gp35-36 бактериофага Т4 в клетках E. coli.

выделялись и очищались.

3. Белок gp35 и комплекс белков gp35-36 экспрессировались при различных условиях экспрессии в нерастворимой форме, а именно, в виде телец включения; при попытке перевода белка gp35 в растворимую форму путем рефолдинга он деградировал.

4. Таким образом, из-за возникших объективных сложностей в экспериментальном исследовании продуктов генов 35 и 36, нам не удалось получить их в препаративных количествах для последующей кристаллизации и решения их вторичной структуры методом рентгеноструктурного анализа.

делеционных мутантов гена 181 в клетках E. coli.

6. Три полученных рекомбинантных белка были выделены и очищены.

7. Установлено, что белок gp181M экспрессируется в нерастворимой форме, в виде телец включения; перевести его в растворимую форму не экспрессируется при пониженной температуре и становится растворимым в присутствии детергента и сахара; солюбилизация в присутствии детергента и сахара косвенно свидетельствует об аффинности этого белка к полисахаридным (LPS) рецепторам клеточной стенки бактерии.

различными штаммами клеток Pseudomonas aeruginosa, но не лизирует их, в отличие от gp181MA.

9. Белок gp181E является не мономером, а димером или тримером, что было установлено с помощью гель-фильтрации.

В результате анализа КД-спектров для белков gp181E и gp181MA было установлено, что их вторичная структура в значительной мере (примерно, на 70%) состоит из -спиралей; этот факт является интересным, т.к. большая часть структурных внутриклеточных белков, например, тропомиозин, миозин, кератин, фибриноген, трансмембранные белки оболочечных вирусов и некоторые глобулярные белки состоят из спиралей.

Предположение о том, что С-концевой домен белка gp181 может играть роль сенсорной “молекулярной” иглы в процессе инфицирования периодичности (Т=8) аминокислотной последовательности этого домена, получило дополнительные экспериментальные обоснования. Однако, вторичная структура этого домена не является родственной -спирали белка gp5 бактериофага Т4, а представляет собой, вероятно, -спиральный coiled coil. Указанное отличие вторичных структур этих белков может определять различие механизмов их взаимодействия с клетками. Можно предположить, что gp181 представляет собой не функциональный гомолог gp5 бактериофага Т4, а довольно распространенный альтернативный случай, когда структурный литический фермент является продолжением “белка-рулетки”, который определяет длину хвоста вируса. Однако, механизм взаимодействия gp181 с клетками до конца еще не исследован.

3.3 Результаты предсказания вторичной структуры мембранных белков вычислительными методами по их аминокислотным последовательностям Исследования мембранных белков (к которым относится и bR) играют очень важную роль, как для развития биологической науки, так и для фармакологии и медицины. Мембранные белки составляют, примерно, 25% всех белков, кодируемых геномом человека. Они отвечают за многие функции клеток, в частности: обеспечивают избирательный обмен веществ между клеткой и окружающей ее средой, поддерживают разность электрических потенциалов внутри клетки и снаружи, обеспечивают передачу электрических сигналов в клетку и из нее, участвуют в производстве и переносе энергии в организме. Поэтому действие более половины фармацевтических препаратов направлено именно на мембранные белки.

Функции, выполняемые белком, определяются его пространственной трехмерной структурой. Определение этой структуры белка представляет собой очень сложную проблему. Основным экспериментальным методом детального исследования структуры мембранных белков является рентгеноструктурный анализ [57, 58]. Этот метод непосредственно применяют к кристаллам белка, которые необходимо предварительно получить, используя очень сложную и трудоемкую технологию. Как отмечалось в литобзоре (п. 1.7.2 главы 1), несмотря на то, что бактериородопсин тщательно изучают более 40 лет, до сих пор не преодолены объективные экспериментальные трудности в достижении высокого кристаллографического разрешения кристаллов bR. Поэтому остается ряд противоречий, касающихся понимания механизма протонного транспорта и данных о структуре bR и его мутантов.

С учетом перечисленных обстоятельств актуальной альтернативой экспериментальному методу рентгеновской кристаллографии при исследовании структуры мембранных белков стали методы компьютерного моделирования, основанные на использовании данных о первичной структуре белка символьной последовательности его аминокислот [145, 146, 148, 150, 177, 182]. Так, например, в работе [177] исследовалась периодичность расположения аминокислот в фибриллярных белках бактериофага Т4 методом преобразования Фурье цифрового образа символьной последовательности аминокислот белка. В частности, была изучена повторяемость расположения аминокислотных остатков (а.о.), принадлежащих к разным группам: гидрофобным или гидрофильным.

Особенность и органическое свойство политопических мембранных белков повторяемость трансмембранных участков, состоящих из аминокислот гидрофобной группы.

Упорядоченную повторяемость (периодичность), которая относится к элементам вторичной структуры белка, можно выявить методом Фурье, применяя его к цифровому образу символьной последовательности аминокислот в белке.

Цель данной части работы выяснение применимости к исследованию вторичной структуры мембранных белков двух частных методов компьютерного моделирования, описанных в главе 2: известного метода с использованием преобразования Фурье и усовершенствованного нами метода "скользящего окна", и сравнение их между собой и с другими известными методами.

В численном эксперименте, описанном в начале главы 3, для нескольких исследованных белков выявлена повторяемость с характерными малыми периодами Т = 8, 10, 15 a.о. и большими Т = 46, 55, 215, 256 a.о.

Последние делят всю последовательность белка на 4 или 6 равных частей и могут быть признаками его третичной структуры [145]. Результаты численного моделирования учтены в успешно выполненном эксперименте, направленном на получение рекомбинантной формы белка gp37 посредством создания химерного белка [182].

Исследование периодичности расположения аминокислот гидрофобной группы в последовательностях мембранных белков методом Фурье. Описанный в главе 2 алгоритм [177] вместе с реализующей его компьютерной программой сначала применили к исследованию периодичности 6 трансмембранных белков. В нижеследующем перечне этих белков приведено название по-русски, по-английски, сокращенное обозначение, код белка и название организма в соответствии с источником [178]:

1) бактериородопсин, bacteriorhodopsin, bR, P02945, Halobacterium salinarium;

2) галородопсин, halorhodopsin, hR, P15647, Natronomonas pharaonis;

3) сенсорный родопсин 2, sensory rhodopsin-2, sR2, P42196, Natronomonas pharaonis;

4) коннексин-32, connexin-32, Cx32, P08034, Homo sapiens;

5) зависимый от циклического нуклеотида калиевый канал, cyclic nucleotidegated potassium channel mll3241, CNG (обозначение, сокращенное авторами данной статьи, так как общепринятого нет), Q98GN8, Mesorhizobium loti;

6) метаботропный глутаматный рецептор 6, metabotropic glutamate receptor 6, GRM6, O15303, Homo sapiens.

Некоторые результаты расчета спектров Фурье представлены на рисунке 3.20. Условием нормировки интенсивностей I(n) гармоник в спектре было равенство I = 1.



Pages:     | 1 || 3 | 4 |

Похожие работы:

«ПОПОВ АНАТОЛИЙ АНАТОЛЬЕВИЧ ФАУНА И ЭКОЛОГИЯ ТАМНО – И ДЕНДРОБИОНТНЫХ ПИЛИЛЬЩИКОВ (HYMENOPTERA, SYMPHYTA) ЦЕНТРАЛЬНОЙ ЯКУТИИ 03.02.05 – энтомология Диссертация на соискание учёной степени кандидата биологических наук Научный руководитель : доктор биологических наук Н.Н. Винокуров Якутск – ОГЛАВЛЕНИЕ Введение. Глава 1. История исследований пилильщиков...»

«Дулепова Наталья Алексеевна ФЛОРА И РАСТИТЕЛЬНОСТЬ РАЗВЕВАЕМЫХ ПЕСКОВ ЗАБАЙКАЛЬЯ 03.02.01 – Ботаника Диссертация на соискание ученой степени кандидата биологических наук Научный руководитель д.б.н., c.н.с., А.Ю. Королюк Новосибирск – 2014 ОГЛАВЛЕНИЕ ВВЕДЕНИЕ ГЛАВА 1. Материалы и методы исследования 1.1. Район и объект исследования 1.2....»

«Лыкшитова Людмила Станиславовна ЭКОЛОГО - БИОЛОГИЧЕСКИЕ ОСОБЕННОСТИ АДАПТАЦИИ MALUS BACCATA (L ), ULMUS PUMILA (L ), SYRINGA VULGARIS( L. ) К ВОЗДЕЙСТВИЮ ФАКТОРОВ ГОРОДСКОЙ СРЕДЫ 03.02.01 – ботаника (биологические науки) 03.02.08 – экология (биологические науки) ДИССЕРТАЦИЯ на соискание ученой...»

«МИЛАНОВСКИЙ Евгений Юрьевич ГУМУСОВЫЕ ВЕЩЕСТВА КАК СИСТЕМА ГИДРОФОБНОГИДРОФИЛЬНЫХ СОЕДИНЕНИЙ Специальность 03.00.27 - почвоведение Диссертация в виде научного доклада на соискание ученой степени доктора биологических наук МОСКВА – 2006 Работа выполнена на кафедре физики и мелиорации почв факультета почвоведения Московского государственного университета им. М.В. Ломоносова Официальные оппоненты :...»

«Кулаков Сергей Сергеевич Очаговое усыхание Pinus sylvstris на юге Красноярского края в результате воздействия корневых патогенов Диссертация на соискание ученой степени кандидата биологических наук по специальности 03.02.08 – Экология Научный руководитель, доктор биологических наук, профессор И.Н. Павлов Красноярск 2014 1 СОДЕРЖАНИЕ Введение.. 1 Современное...»

«КРЕТЕНЧУК ОКСАНА ФЕДОРОВНА РАЗРАБОТКА НОВЫХ ПРЕПАРАТОВ НА ОСНОВЕ МОНОКЛОНАЛЬНЫХ АНТИТЕЛ ДЛЯ ДИАГНОСТИКИ ХОЛЕРНЫХ ВИБРИОНОВ О1, О139 СЕРОГРУПП УСКОРЕННЫМИ МЕТОДАМИ 03.01.06 – биотехнология (в том числе бионанотехнологии) Диссертация на соискание...»

«НИЗКИЙ СЕРГЕЙ ЕВГЕНЬЕВИЧ ВОЗМОЖНОСТЬ ИСПОЛЬЗОВАНИЯ БИОЛОГИЧЕСКИХ РЕСУРСОВ АНТРОПОГЕННО НАРУШЕННЫХ ЗЕМЕЛЬ В АМУРСКОЙ ОБЛАСТИ 03.02.14 – биологические ресурсы (биологические наук и) Диссертация на соискание ученой степени доктора биологических наук Благовещенск...»

«Семёнов Михаил Александрович Экологические механизмы формирования экосистемного биоразнообразия при искусственном лесовосстановлении (на примере Цнинского лесного массива) Специальность 03.02.08 – экология Диссертация на соискание ученой степени Кандидата биологических наук Научный руководитель : доктор биологических наук,...»

«СЕРГЕЕВА ЛЮДМИЛА ВАСИЛЬЕВНА ПРИМЕНЕНИЕ БАКТЕРИАЛЬНЫХ ЗАКВАСОК ДЛЯ ОПТИМИЗАЦИИ ФУНКЦИОНАЛЬНО-ТЕХНОЛОГИЧЕСКИХ СВОЙСТВ МЯСНОГО СЫРЬЯ И УЛУЧШЕНИЯ КАЧЕСТВА ПОЛУЧАЕМОЙ ПРОДУКЦИИ Специальность 03.01.06 – биотехнология ( в том числе бионанотехнологии) Диссертация на соискание ученой степени кандидата биологических наук Научный руководитель Доктор биологических наук, профессор Кадималиев Д.А. САРАНСК ОГЛАВЛЕНИЕ ВВЕДЕНИЕ.....»

«ЧИКИНА ЕЛЕНА ЭНГЕЛЬСОВНА ФОТОДИНАМИЧЕСКАЯ ТЕРАПИЯ ОСТРЫХ И ХРОНИЧЕСКИХ ВЕРХНЕЧЕЛЮСТНЫХ СИНУСИТОВ 03.00.02 - биофизика 14.00.04 – болезни уха, горла и носа Диссертация на соискание ученой степени кандидата медицинских наук Научные руководители: доктор медицинских наук, профессор О.В. Мареев кандидат физико-математических наук А.Н. Башкатов Саратов - 2005 г....»

«УДК 612.821.6; 612.825 НОВИКОВА Маргарита Робертовна РОЛЬ ОРБИТО-ФРОНТАЛЬНОЙ КОРЫ И ГИППОКАМПА В АДАПТИВНО-КОМПЕНСАТОРНЫХ ПРОЦЕССАХ ПРИ ПОРАЖЕНИИ СТВОЛА МОЗГА КРЫС Специальность 03.00.13 Физиология Биологические наук и Диссертация на соискание ученой степени кандидата биологических наук Научные руководители: Д.б.н., проф. В.П.Подачин Д.б.н. Е.В.Шарова Москва – СОДЕРЖАНИЕ: Стр. ОГЛАВЛЕНИЕ.. ВВЕДЕНИЕ.. ГЛАВА 1....»

«НОВИКОВ Сергей Геннадьевич ЭКОЛОГИЧЕСКАЯ ОЦЕНКА ЗАГРЯЗНЕНИЯ ТЯЖЁЛЫМИ МЕТАЛЛАМИ ПОЧВ УРБАНИЗИРОВАННЫХ ТЕРРИТОРИЙ ПО КАТЕГОРИЯМ ЗЕМЛЕПОЛЬЗОВАНИЯ (НА ПРИМЕРЕ Г. ПЕТРОЗАВОДСКА) Специальность 03.02.08 – экология ДИССЕРТАЦИЯ на соискание ученой степени кандидата биологических наук научный руководитель: доктор сельскохозяйственных наук, профессор Федорец Наталия Глебовна...»

«ЧУДНОВСКАЯ ГАЛИНА ВАЛЕРЬЕВНА БИОЭКОЛОГИЯ И РЕСУРСЫ ЛЕКАРСТВЕННЫХ РАСТЕНИЙ ВОСТОЧНОГО ЗАБАЙКАЛЬЯ Специальность 03.02.08 – Экология Диссертация на соискание ученой степени доктора биологических наук Научный консультант : Чхенкели Вера Александровна, доктор биологических наук, профессор Иркутск – СОДЕРЖАНИЕ Введение.. Глава 1. Обзор литературы по состоянию проблемы исследований ресурсов лекарственных растений.. 1.1...»

«Подсвирова Ирина Александровна Микробиологический мониторинг патогенов гнойновоспалительных заболеваний в хирургических отделениях и в отделении реанимации и интенсивной терапии в многопрофильном стационаре 03.02.03 – микробиология Диссертация на соискание учёной степени кандидата медицинских наук...»

«Никитенко Елена Викторовна МАКРОЗООБЕНТОС ВОДОЕМОВ ДОЛИНЫ ВОСТОЧНОГО МАНЫЧА 03.02.10 – гидробиология Диссертация на соискание учёной степени кандидата биологических наук Научный руководитель : доктор биологических наук, Щербина Георгий Харлампиевич Борок – 2014 СОДЕРЖАНИЕ ВВЕДЕНИЕ ГЛАВА 1. ОБЗОР ЛИТЕРАТУРЫ ГЛАВА 2. ФИЗИКО–ГЕОГРАФИЧЕСКАЯ ХАРАКТЕРИСТИКА РАЙОНОВ ИССЛЕДОВАНИЯ...»

«КОЗЛОВА Юлия Олеговна РАЗРАБОТКА ТЕХНОЛОГИИ ПРЕ- И ПОСТНАТАЛЬНОЙ ДИАГНОСТИКИ ГРУППЫ СИНДРОМОВ, ОБУСЛОВЛЕННЫХ МИКРОДЕЛЕЦИЕЙ 22q11.2 03.02.07 – генетика Диссертация на соискание ученой степени кандидата медицинских наук Научный руководитель : доктор биологических наук, профессор Т.В. Золотухина Москва 2014 ОГЛАВЛЕНИЕ ВВЕДЕНИЕ Актуальность темы исследования...»

«Жданова Оксана Леонидовна Математическое моделирование естественной эволюции структурированных биологических популяций и эволюционных последствий промысла Специальность 03.01.02 – биофизика Диссертация на соискание ученой степени доктора физико-математических наук Научный консультант чл.-корр. РАН, профессор Фрисман Е.Я....»

«Кузьменко Александр Анатольевич РАСТИТЕЛЬНОСТЬ МОРЕННЫХ И ВОДНО-ЛЕДНИКОВЫХ РАВНИН ЮЖНОЙ ОКРАИНЫ СМОЛЕНСКОЙ ВОЗВЫШЕННОСТИ Специальность 03.02.01 – Ботаника Диссертация на соискание учёной степени кандидата биологических наук Научный руководитель : доктор...»

«Петренко Дмитрий Владимирович Влияние производства фосфорных удобрений на содержание стронция в ландшафтах Специальность 03.02.08 - экология Диссертация на соискание ученой степени кандидата биологических наук Научный руководитель : доктор биологических наук, профессор Белюченко Иван Степанович Москва – 2014 г. Содержание Введение Глава 1. Состояние изученности вопроса и цель работы 1.1...»

«Юсупов Ильдар Равилевич ЕСТЕСТВЕННОЕ ВОЗОБНОВЛЕНИЕ ЕЛИ СИБИРСКОЙ (PICEA OBOVATA LEDEB.) И ПИХТЫ СИБИРСКОЙ (ABIES SIBIRICA LEDEB.) В ПРОВИНЦИИ ШИРОКОЛИСТВЕННО-ТЕМНОХВОЙНЫХ ЛЕСОВ ЮЖНОГО УРАЛА (НА ПРИМЕРЕ ЮЖНО-УРАЛЬСКОГО ГОСУДАРСТВЕННОГО ПРИРОДНОГО ЗАПОВЕДНИКА) Специальность 03.02.01 – ботаника диссертация на соискание ученой степени кандидата биологических наук...»





 
© 2013 www.diss.seluk.ru - «Бесплатная электронная библиотека - Авторефераты, Диссертации, Монографии, Методички, учебные программы»

Материалы этого сайта размещены для ознакомления, все права принадлежат их авторам.
Если Вы не согласны с тем, что Ваш материал размещён на этом сайте, пожалуйста, напишите нам, мы в течении 1-2 рабочих дней удалим его.