WWW.DISS.SELUK.RU

БЕСПЛАТНАЯ ЭЛЕКТРОННАЯ БИБЛИОТЕКА
(Авторефераты, диссертации, методички, учебные программы, монографии)

 

На правах рукописи

Песенцева Мария Сергеевна

ФЕРМЕНТЫ МОРСКОГО МОЛЛЮСКА Littorina sitkana:

13--D-ГЛЮКАНАЗА, -D-ГЛЮКОЗИДАЗА, СУЛЬФАТАЗА

И ТИРОЗИЛПРОТЕИН СУЛЬФОТРАНСФЕРАЗА

02.00.10 – Биоорганическая химия

Автореферат диссертации на соискание ученой степени

кандидата химических наук

Владивосток – 2013  

Работа выполнена в Федеральном государственном бюджетном учреждении науки Тихоокеанском институте биоорганической химии им. Г.Б. Елякова ДВО РАН и Национальном институте агрономических исследований (Нант, Франция) Научные руководители: доктор химических наук, профессор Звягинцева Татьяна Николаевна профессор Эртле Тома

Официальные оппоненты: Муронец Владимир Израилевич доктор биологических наук, профессор, МГУ им. М.В. Ломоносова, Научноисследовательский институт физикохимической биологии им. А.Н. Белозерского, заведующий отделом биохимии животной клетки Усов Анатолий Иванович доктор химических наук, профессор, Институт органической химии им. Н.Д.

Зелинского РАН, заведующий лабораторией растительных полисахаридов

Ведущая организация: Федеральное государственное бюджетное учреждение науки Институт химической биологии и фундаментальной медицины СО РАН, г. Новосибирск

Защита состоится «03» сентября 2013 г. в 1300 часов на заседании диссертационного совета Д 005.005.01 при Федеральном государственном бюджетном учреждении науки Тихоокеанском институте биоорганической химии им. Г.Б. Елякова ДВО РАН по адресу: 690022, г. Владивосток, проспект 100 лет Владивостоку, 159, ТИБОХ ДВО РАН. Факс: (423)231-40-50, e-mail: dissovet@piboc.dvo.ru

С диссертацией можно ознакомиться в филиале Центральной научной библиотеки ДВО РАН (г. Владивосток, проспект 100 лет Владивостоку, 159, ТИБОХ ДВО РАН).

Текст автореферата размещен на сайте www.piboc.dvo.ru Автореферат разослан « » августа 2013 г.

Ученый секретарь диссертационного совета, к.б.н. Черников О.В.

 

ОБЩАЯ ХАРАКТЕРИСТИКА РАБОТЫ

Актуальность проблемы. Морские организмы, на жизнедеятельность которых влияет множество факторов (соленость океанических вод, гидростатическое давление, колебания температур, освещенность и другие), продуцируют эффективные и стабильные ферменты различной специфичности. Изучение структуры и каталитических свойств этих ферментов является актуальной задачей современной энзимологии.





Данная работа посвящена исследованию двух групп ферментов из морских моллюсков: О-гликозидгидролаз, катализирующих трансформацию углеводов и углеводсодержащих веществ, и ферментов, участвующих в метаболизме соединений, содержащих сульфатную группу.

О-гликозидгидролазы: 13--D-глюканазы (ламинариназы) и -D-глюкозидазы, являются ключевыми ферментами метаболизма углеводов. К настоящему времени имеется ряд данных о структуре и механизме действия ламинариназ и глюкозидаз из морских беспозвоночных. Особенностью этих ферментов является способность катализировать с одинаковой эффективностью как реакции гидролиза, так и синтеза О-гликозидных связей. Субстратами ламинариназ являются 13--D-глюканы и смешанные 13;14- и 13;16--D-глюканы, представляющие собой полифункциональные соединения и нередко обладающие иммуномодулирующей, противоопухолевой и радиопротекторной активностью. Изучение механизма действия, свойств и структуры новых О-гликозидгидролаз позволит расширить теоретические знания об этих ферментах и создаст основу для их практического использования в установлении структуры олиго- и полисахаридов и в ферментативном синтезе новых биологически активных соединений.

Сульфатирование и десульфатирование биомолекул морского происхождения и роль этих процессов в жизнедеятельности морских организмов в настоящее время практически не изучены, несмотря на то, что сульфатированные углеводы, белки и вторичные метаболиты в них широко представлены. Поэтому изучение сульфатаз, катализирующих гидролиз сульфоэфирных связей, и тирозилпротеин сульфотрансфераз, которые катализируют широко распространенный в организмах процесс переноса сульфатной группы на молекулы белков и пептидов, является важной задачей. С участием этих ферментов осуществляются детоксикация ксенобиотиков, белок-белковые взаимодействия, в которых участвуют белки системы гемостаза, хемотаксиса, а также белки, вовлечённые в развитие вирусных инфекций и онкологических заболеваний.

Цель и задачи работы. Цель работы – изучение специфичности, механизма действия и структуры некоторых гидролаз морских моллюсков (ламинариназ, -Dглюкозидаз, сульфатаз), катализирующих трансформацию углеводсодержащих природных соединений, а также тирозилпротеин сульфотрансфераз.

Для достижения этой цели были поставлены следующие задачи:

1) выбрать моллюсков с высоким уровнем активности ферментов; 2) разработать схемы очистки О-гликозидгидролаз и сульфатаз из выбранных объектов; 3) исследовать основные биохимические свойства, специфичность и тип действия выделенных ферментов; 4) установить первичную структуру эндо-13--D-глюканазы и ее принадлежность к определенному структурному семейству О-гликозидгидролаз;

5) исследовать трансгликозилирующую активность новых О-гликозидгидролаз; 6) провести сравнительный анализ специфичности сульфатаз морских моллюсков из различных мест обитания; 7) разработать методы поиска тирозилпротеин сульфотрансфераз, продуцируемых морскими беспозвоночными и установить аминокислотную последовательность этого фермента.





Научная новизна и практическая значимость работы. В результате проведенных исследований найдены новые источники ферментов, катализирующих не только реакции гидролиза, но и переноса функционально значимых остатков глюкозы и сульфатных групп. Из морского моллюска Littorina sitkana выделены гомогенные эндоD-глюканаза (КФ 3.2.1.39) и -D-глюкозидаза (КФ 3.2.1.21). Определены биохимические свойства, специфичность, тип действия и трансгликозилирующая активность этих ферментов. Установлены первичные структуры эндо-13--Dглюканазы и тирозилпротеин сульфотрансферазы из L. sitkana. Выделены и охарактеризованы две новые сульфатазы из брюхоногих моллюсков L. sitkana и Turbo сhrysostomus, катализирующие гидролиз сульфатной группы в тритерпеновых гликозидах голотурий. Получены данные о природных соединениях, оказывающих ингибирующие или активирующие действие на исследуемые ферменты.

Изучение молекулярных и каталитических свойств О-гликозидгидролаз позволило выявить особенности действия этих ферментов и определить возможности их практического использования в исследованиях структуры углеводсодержащих веществ и синтезе новых биологически активных гликоконьюгатов.

Основные положения, выносимые на защиту.

1. Эндо-13--D-глюканаза (КФ 3.2.1.39), выделенная из печени брюхоногого моллюска L. sitkana, на основании установленной аминокислотной последовательности отнесена к 16-му структурному семейству О-гликозидгидролаз.

2. Эндо-13--D-глюканаза из L. sitkana синтезирует  как  13,  так  и  гликозидные  связи,  её  трансгликозилирующая активность выше гидролитической, что отличает эту глюканазу от известной эндо-13--D-глюканазы из морского моллюска Pseudocardium (Spisula) sachalinensis.  3. -D-Глюкозидаза (КФ 3.2.1.21), выделенная из печени L. sitkana, обладает необычной способностью катализировать гидролиз ламинарана.

4. Моногалактодиацилглицерин, выделенный из бурой водоросли Fucus evanescens, действует на активность -D-глюкозидазы и эндо-13--D-глюканазы из L. sitkana подобно известным ингибиторам нойримицину и глюконолактону.

5. Арилсульфатазы (КФ  3.1.6.1), выделенные из печени брюхоногих моллюсков L.

sitkana и T. chrysostomus,  катализируют гидролитическое отщепление сульфатной группы в положении С4 остатка ксилозы, входящей в состав углеводных цепей гликозидов голостанового ряда.

6. Методом Вестерн-блота показано присутствие ТПСТ в некоторых видах морских моллюсков. Установлена аминокислотная последовательность ТПСТ L. sitkana.

Апробация работы. Материалы данной работы были представлены автором в виде стендовых и устных сообщений на IV Европейской конференции «Marine natural products», Франция, 2005 и на I международном симпозиуме «Marine Enzymes and Polysaccharides», Вьетнам, 2012.

Публикации. По материалам диссертации опубликовано 5 статей в журналах из списка ВАК РФ и 3 тезисов докладов в материалах научных конференций.

Личный вклад соискателя в проведении исследования. Соискателем были выполнены анализ литературы, планирование экспериментов, написаны статьи и подготовлены доклады на конференциях. На защиту вынесены только те положения и результаты, в получении которых роль соискателя была определяющей.

Структура диссертации. Диссертационная работа содержит следующие разделы:

Введение, Литературный обзор, Результаты и их обсуждение, Экспериментальную часть, Выводы и Список литературы. Список литературы вкючает 208 источника.

Диссертация изложена на 138 страницах и содержит 21 таблицу и 41 иллюстрацию.

Сокращения и условные обозначения. а.о. – аминокислотный остаток, ВЭЖХ – высокоэффективная жидкостная хроматография, ДСН – додецилсульфата натрия, ИЭР МС/МС – тандемная масс-спектрометрия с ионизацией электрораспылением, МАЛДИ МС – масс-спектрометрия с матрично-активированной лазерной десорбцией/ионизацией, PMSF – фенилметилсульфонилфторид, п.н. – пара нуклеотидов, ТПСТ – тирозилпротеин сульфотрансфераза, ФАФС – 3’фосфоаденозин-5’-фосфосульфат.

ОСНОВНОЕ СОДЕРЖАНИЕ РАБОТЫ

Поиск среди морских моллюсков (около 40 видов) источников Огликозидгидролаз, сульфатаз и ТПСТ показал, что печень L. sitkana продуцирует все вышеназванные ферменты в значительных количествах. Необходимо отметить, что ранее печень этого моллюска была выбрана для выделения альгинат-лиазы и фукоидангидролазы (Фоворов В.В., Кусайкин М.И.).

1 Эндо-13--D-глюканаза GI из L. sitkana Экстракт печени L. sitkana был проанализирован на содержание полисахаридгидролаз (фукоиданазы, амилазы, целлюлазы, агаразы, пустуланазы) и гликозидаз (-D-глюкозидазы, -D-галактозидазы, -D-маннозидазы, -D-фукозидазы).

Наибольшую активность среди О-гликозидгидролаз проявляла 13--D-глюканаза.

Фермент с удельной активностью 0,285±0,1 ед/мг и выходом 3,7 % получен согласно схеме, представленная в таблице 1.

Таблица 1 – Схема выделения 13--D-глюканазы GI из печени L. sitkana Хроматография на ДЭАЭ-целлюлозе Рехроматография на ДЭАЭ-целлюлозе Гельфильтрация на сефадексе Анализ фермента методом ДСН-электрофореза в полиакриламидном геле показал единственную полосу белка с молекулярной массой 40±1 кДа (рис. 1). Молекулярная масса нативного фермента, оцененная гель-фильтрацией, составила 32 кДа. Подобное занижение значения молекулярной массы может быть связано с компактной конформацией белка в растворе. Более точное значение молекулярной массы 13--D-глюканазы GI (39,3 кДа) получено методом МАЛДИ МС. Расчетная молекулярная масса на основании аминокислотной последовательности белка GI составила 36,7 кДа; она заметно отличалась от экспериментальной, полученной МАЛДИ МС, что, возможно, связано с посттрансляционными модификациями молекулы.

Максимальная активность GI наблюдалась при значении рН 5,4, что хорошо коррелирует с литературными данными. Температурный оптимум GI составил 40 оС, а инактивация фермента наблюдалась при 45 оС.

Специфичность глюканазы GI устанавливали с молекулах -D-глюканов: с высокой скоростью гидролизовал растворимые глюканы, ламинаран и транслам, и с меньшей скоростью более высокомолекулярные и мало растворимые 13;14- и 13;16--D-глюканы. Фермент не действовал на глюканы с другим типом связи.

Глюканаза GI катализировала гидролиз периодатно-окисленного ламинарана с той же скоростью, что и исходного ламинарана. Это характерно для ферментов эндотипа действия, гидролизующих внутренние связи полимерного субстрата.

Значение Кm гидролиза ламинарана составило 0,13 мг/мл, что сопоставимо с Кm, полученными для других эндо-13--D-глюканаз из морских источников.

Таблица 2 – Специфичность 13--D-глюканазы из L. sitkana Периодатно-окисленный * х.р. – хорошо растворим в воде; п.р. – плохо растворим в воде Нами были изучены особенности реакции гидролиза ламинарана 13--Dглюканазой GI. Для анализа продуктов гидролиза использовали методы МАЛДИ МС и ВЭЖХ. В масс-спектрах продуктов гидролиза ламинарана 13--D-глюканазой (рис.

2) обнаружены сигналы ионов, соответствующие глюкозе и глюкоолигосахаридам с различной степенью полимеризации: [Glc+Na]+ с m/z 203,01, [Glc2+Na]+ с m/z 365,11, [Glc3+Na]+ с m/z 527,17, [Glc4+Na]+ с m/z 689,23, [Glc5+Na]+ с m/z 851,28, [Glc6+Na]+ с m/z 1013,34, [Glc7+Na]+ с m/z 1175,4, [Glc8+Na]+ с m/z 1337,46 (рис. 2 А). Кроме того, в масс-спектрах, которые соответствуют начальным стадиям реакции, имеются сигналы ионов [GlcnГекситол+Na]+, которые характерны для ламинариолигосахаридов с остатком D-маннита, расположенным на восстанавливающем конце молекулы.

Появление таких олигозидов на начальных стадиях реакции свидетельствует о том, что фермент атакует молекулу субстрата ближе к восстанавливающему концу. Ранее это свойство обнаружено у эндо-13-D--глюканаз из Pseudocardium sachalinensis и Chlamys albidus.

Метод ВЭЖХ использовали для количественной оценки массспектрометрических данных. На рисунке 2 Б видно, что фермент GI расщепляет ламинаран с образованием низкомолекулярных продуктов: ламинариолигосахаридов и глюкозы, при этом количество глюкотриозы значительно превышало количество других олигосахаридов.

Рисунок 2 – (А) МАЛДИ масс-спектр продуктов гидролиза ламинара GI (степень гидролиза субстрата 20 %); (Б) ионообменная ВЭЖХ на колонке Asahipak NH2P- (мобильная фаза – ацетонитрил:вода mQ, 6:4, скорость потока – 0,5 мл/мин, детектор – рефрактометр) продуктов исчерпывающего гидролиза ламинарана GI Механизм действия эндо-13--D-глюканазы из L. sitkana устанавливали с помощью методов поляриметрии и 13С ЯМР спектроскопии. Результаты поляриметрии показали, что гидролиз протекал без изменения конфигурации расщепляемой связи. Эти данные согласовывались с результатами, полученными методом 13С ЯМР спектроскопии. На рисунке 3 приведены спектры исходного ламинарана (0 мин) и продуктов, полученных за 15, 30 и 45 мин ферментативной реакции. На спектре продуктов (15 мин) появляются новые сигналы в области 97, м.д., которые соответствуют -конфигурации С1.

Рисунок 3 – 13С ЯМР спектры ламинарана из L. cichorioides (0 мин) и продуктов его гидролиза эндо-13--D-глюканазой из L. sitkana (15, 30, 45 мин) На последующих минутах реакции сигнал, соответствующий -конфигурации С1 – 97,2 м.д., увеличивается, и появляется новый сигнал в области 93,7 м.д., соответствующий -конфигурации С1. Этот сигнал появляется уже как следствие мутаротации, что позволяет сделать вывод о «сохраняющем» конфигурацию механизме гидролиза.

Известно, что для «сохраняющих» О-гликозидгидролаз характерна способность к реакции трансгликозилирования. Для исследования этой активности у фермента GI использовали следующие акцепторы: метанол, метил--D-глюкопиранозид и метил-D-ксилопиранозид. Продукты гидролиза ламинарана (олигосахариды) и трансгликозилирования (метилгликозиды) с различной степенью полимеризации исследовали методом МАЛДИ МС (табл. 3).

Таблица 3 – Продукты реакции трансгликозилирования, полученные действием глюканазы GI с использованием ламинарана в качестве донора и метанола (MeOH), метил--D-глюкопиранозида (OMe--D-Glc) и метил--D-ксилопиранозида (OMe--D-Xyl) в качестве акцепторов Рисунок 4 – МАЛДИ масс-спектры продуктов трансформации ламинарана, катализируемой ферментом GI в присутствии различных акцепторов: метил--Dглюкопиранозида (А) метил--D-ксилопиранозида (Б) и метанола (В) Результаты исследования показали, что фермент GI эффективно катализировал перенос гликоновой части донора на метил--D-глюкопиранозид и метил--D-ксилопиранозид. Интенсивность сигналов продуктов трансгликозилирования с этими акцепторами (рис. 4 А, Б) превышала интенсивность сигналов продуктов гидролиза. При использовании метанола как акцептора (рис. 4 В) равновесие реакции сдвигалось в сторону реакции гидролиза.

Положение гликозилирования в продуктах реакции трансгликозилирования устанавливали с использованием 6-О-метил--D-глюкуроновой кислоты (GlcAOMe) в качестве акцептора. Продукты реакции, меченные GlcAOMe, деметилировали, и массспектры получали для GlcA-глюкозидов. Анализ ИЭР МС/МС спектров, полученных для осколочных фрагментов, позволил установить тип образующейся связи. Было сделано заключение, что эндо-13--D-глюканаза GI переносит остатки глюкозы молекулы субстрата главным образом в С3 и С4 положение -D-глюкуроновой кислоты и в С3 положение остатка глюкозы. В масс-спектрах были идентифицированы дисахариды Glc-(13)-GlcA, Glc-(14)-GlcA и трисахариды Glc-(13)-Glc(13)-GlcA, Glc-(13)-Glc(14)-GlcA.

Первичную структуру эндо-13--D-глюканазы из L. sitkana определяли с помощью методов молекулярной биологии. Методом быстрой амплификации кДНК концов установлена полная нуклеотидная последовательности кДНК, кодирующая фермент GI, которая состояла из 1636 п.н. Анализ последовательности кДНК показал, что она включает в себя одну протяжённую открытую рамку считывания длиной п.н., которая кодирует полипептид из 442 а.о. Информация о первичной структуре белка была внесена в генетическую базу данных GeneBank с номером FJ641204.

Аминокислотная последовательность зрелого белка составила 322 а.о.

Множественное выравнивание аминокислотной последовательности эндоD-глюканазы из L.sitkana с последовательностями глюканаз из других беспозвоночных: двустворчатых моллюсков P. sachalinensis, Mezuhopecten yessoensis, Ch. albidus, Perna viridis, морского уха Haliotis discus hannai, червей Helicoverpa armigera и Tenebrio molitor, антарктической ногохвостки Cryptopygus antarcticus и древесной нематоды Bursaphelenchus xylophilus, показано на рисунке 5.

Сравнение аминокислотной последовательности GI и эндо-13--D-глюканаз других видов беспозвоночных показало высокую степень гомологии, 52–67 %. Анализ аминокислотной последовательности эндо-13--D-глюканазы из L. sitkana с помощью сервера SMART показал, что фермент содержит каталитический домен, характерный для О-гликозидгидролаз 16-го семейства, длиной 226 а.о. (M49–К374).

Эндо-13--D-глюканаза GI содержит два консервативных участка, характерных для О-гликозидгидролаз семейства GH16. Один из этих участков EIDIME (152-157), как показано ранее, является каталитическим и включает два консервативных остатка глутаминовой кислоты, которые принимают непосредственное участие в каталитических процессах. Вторая консервативная последовательность WLWPAIW (130-136) является, предположительно, участком связывания субстрата.

Множественное выравнивание аминокислотных последовательностей эндо-13--Dглюканаз выявило наличие следующих консервативных остатков: W129, W131, W146, W209, W283, W295, W301, W305, F9, F252, F256, F271 и F294 (а.о., нумерованные для GI), а также 5 гомологичных замен (F5, W19 W177, W205, и F270) (рис. 5). Эти ароматические а.о. (или некоторые из них) предположительно принимают участие в связывании полимерного субстрата (ламинарана) вне области активного центра.

Кроме этого, выявлено два остатка гистидина, H176 и H203, которые являются консервативными для эндо-13--D-глюканаз (рис. 5). Участие остатков гистидина в каталитическом процессе также было показано на примере других эндо-13--Dглюканаз. Глюканаза GI содержит два остатка цистеина, C82 и C90, которые консервативны для эндо-13--D-глюканаз большинства беспозвоночных и участвуют в образовании дисульфидных мостиков.

L.sitkana (FJ641204) ----------------------GAVMFRDDFNGGGLDTNN---WNYEVS-MYGGMNWEFQVYTND-KSNVYTNNGKLFLKPTKTVDDPRWDENFLHSGVMDVAQIWG--YCTQSAQYGCHRE T.molitor (ACS36221) --ATPSPTTASGTHAPTGEICSGDLIFEDEFDE--LDMQK---WNHEST-LGGGGNWEFEWYTNS-RYNSYTEDGFLYIKPTLLAD--ENGEDFLSSGQLDINGGSPADECTNPQWYGCART S.purpuratus (AAC47235) ----------------------NGLIFQEEFDS--FNLDI---WEHEMT-AGGGGNWEFEYYTNN-RSNSYVRDGKLFIKPTLTTD--KLGEGSLSSGTLDLWGSSPANLCTGNAWYGCSRT H.armigera (ABU98621) ----------------------GALIFADDFDS--FDLEK---WQHENT-LAGGGNWEFQYYNNN-RTNSFTHSGRLFIRPSLMSD--QFGEQFLSSGHLNVEGGAPADRCTNPQWWGCERT P.sachalinensis(AAP74223)----------------------GTVVFRDDFNG-AFDPAG---WNYEVS-MYGGYNWEVQAYVPD-ARNIFTRNGHLFIKPTLTTDHPNYNDGNLNSATMDLTALYG--YCTNADRYGCIRE ------------------------AGFRDDFTT--WNPNN---YQIGVS-AWGGGNHEFQVYTPE-PSNLFVRDGSLYIKPTFTRDSRHFTDGNLYYGTMDLYHLWN--KCTQHDNNGCQKH Ch.albidus(DQ093347) ------------------------AGFRDDFTT--WDPSD---YQIEVS-AWGGGNHEFQVFTPE-PSNLFVRNGNLYIKPTFTRDSAHFNDGSLYYGTMDVNSLWH--RCTQHDNNGCHKQ M.yessoensis(AY848857) P.viridis (ACM68926) -----------------------AVVFRDDFHS--FNKGS---YKIECS-AWGGGNHEFQVYVNE-PSNLYARGGHFYLKPTLTTDDPRYDDNRLYHGQMKVTDFCGGGPCTQSANWGCDRT H.discus (BAH84971) ----------------------GNTVFEDSFNSHQLNPKH---WHHEIT-CWGGGNGEFQMYTPE-AANTYIKNGVLYLKPTFTAD--KFGDDFFQHGVLDVKQQWG--SCTAAQDNGCRRQ C.antarcticus (ACD93221) ------------------------LDWEDEFNGGNLAD----RWNFELG-CNGWGNNELQCYTDNRGANARQEDGKLVISAVREWWGDGVNPD----------------------------- -----------------------GVIWQEDFNSLDTS-----KWNFETGNNNGWGNSELECYTTS-SNNVRVENGNLVIEARRENV-DGCS------------------------------- B.xylophilus(BAE02683)

---GKNGILPPVMSGKVKSKP--VLKYGTVEVRARIP-KGDWLWPAIWMLPR--DSHYGGWPRSGEIDIMESRGNVRASG-----HGVNEVSSTLHWGTSAGDNHYGQTTH--AKQAADW

L.sitkana

--GTADNYLNPIKSARIRSLYSLSFKYGKVEVRAKLP-TGDWLWPAIWMLPR--WNQYSGWPISGEIDIMESRGNADLVNASGANIGSKLVSSTLHWGPAWNINMYMMTHVESSNPAG-F

T.molitor

--GSNDNLLNPIQSARLRTVESFSFKYGRLEVEAKLP-TGDWLWPAIWLLPK--HNGYGEWPASGEIDLVESRGNADIKDADGLSAGVDQMGSTMHWGPFWPLNGYPKTHAT--------

S.purpuratus

--GSPSNILNPIKSARIRTVNSFSFRYGRVEVRAKMP-AGDWLWPAIWLMPA--YTTYGTWPASGEIDLVESRGNRAMT-FNGVHIGTHEAGSTLHYGPYPAMNGWERAHWIRRNTAG-Y

H.armigera

---GRNGILPPVMSGKIKSKK--TIRFGKVEARCRIP-RGDWIWPAIWMLPR--DSVYGGWPRSGEIDMMESRGNTVARDGSGHNHGVNEVG-HLHWDQMPVIIDSVRRT---GDLDGDW

P.sachalinensis

SYGGNSEILPPVMSGKITTNF--AMTYGRVNVRAKIP-KGDWLWPAIWMLSR--DRSYGGWPRSGEIDIMESRGNTKAVLW-GQNSGVNYVASTLHWGPDFNNNRFQKTHGSKRKSGGAD

C.albidus

SYGGDSEILPPVMSGKITTNF--AMTYGRVNVRAKIP-KGDWLWPAIWMLPR--DWSYGGWPRSGEIDIMESRGNTKAILG-GQNSGVNYVASTLHWGPAYNHNAFAKTHASKRKYGGDD

M.yessoensis

AVNGN--VLNPIKSGKVTTNA--AIRYGTVTVRARIP-EGDWLWPAIWMLPR--DWKYGGWPRSGEIDLMEARCNSYMKCG-SNLEGVQEVASTLHWGPDAGQNRFYKTHGELDKGSGDW

P.viridis

---GA--QIPPIMSSKVFSVA--SITHGRVEVVAKIP-KGDWIWPAIWLLPPGWPWKYGAWPASGEIDIMESRGNVHLSEANGATQGVDRVLSTIHYGASPSQHRQQGDSK-TSKTGTTW

H.discus ---------KEFTSARMTT--KANWLHGKFEMRARLP-KGKHLWPAFWMMPQ--NSEYGGWPRSGEIDITEYR-----------GQRPQQILGTLHFGAAPDNKGDVGTGE--RDFPIDF C.antarcticus -----------FTSGRIHTRGKFDFKYGTIEARIKLPNLANGLWPAFWMLG----AESNTWPDQGEMDIMEAG----VADAIAAGNVNKEILGTFHWSNN-GQHAQYGTN---YVAPNDL B.xylophilus

SNSFHTWRLEWTHDHIATFVDNQQILRVTPPSGGFSELGHTS------N-IWAGND-KMAPFDKEFYAIFNVAVGGTNGFFPENW-DYGYPKPWSNTSPHAAQDWWNGRSKWESSWQGD-

L.sitkana

DADWHNYQMTWTENDISFSIDDALLGTFAPPDGGFWEWGDLD--SSGFANPWRTSKSEMAPFDQEFYLLINLACGGMA-YFPDDV-TNPGGKPWSNTSPTASTDFWKGRDQWLPTWKLET

T.molitor ----------------KFYVDDELLLNVDPATG-FWDLGEFENDAPGIDNPWAYNPNKLTPFDQEFYLILNVAVGGVN-YFGDGL-TYTPAKPWSNDSPTASKDFWSDFNTWYPTWNGE- S.purpuratus

NSNFHRYQLEWTPDYLRFSIDDLELGRVTPGNGGFWEFGGFNS-NPNIENPWRYG-SKMAPFDEKFYLIINLAVGGTNGFFPDGV-SNPNPKPWWNGSPTAATGFWNGRWGWLPTWNLGV

H.armigera

SHAMHTYRLDWTIDHIQVFVDNRHIMNIPQSRKVFGSLEDLV------DPIFGAVEPKAAPFDKQFYLILNVAIAGTNGFFPDNW-TYDQQKPWFSNSPTELQDFWNARFQWLQTWHGD-

P.sachalinensis

WHGWHTYSLDWTAGHIVTYVDNVEIMRITTPSQSFWGWGAFS------GNNIWASGGKNAPFDKPFHLILNVAVGG--DFFADG--DYDVPKPWGGHNPMR--SFWEARHSWENTWKGD-

C.albidus

WHGWHTYSLDWTADHIITYVDNVEMMRINTPSQSFWGWGGFD------GNNIWASGGKNAPFDKPFHLILNVAVGG--DYFGNG--EYDVPKPWGNHNPMR--SFWEARHSWEHTWQGD-

M.yessoensis

ADGFHTYKLEWDANHIRVTVDGRQILYVSTPGNSYWGWGGFG------GSNPWAGGGRDAPFDQYFQLILNVAVGG--QYFPQGC-AYNHPRPWHDGSPRQEAEFYEKKSEWLSTWHGE-

P.viridis

ADSFHTYSVDWTAGHIRMDIDNQPVMAWTTPSQGYWSYSHQS------GTNVWSQGGNDAPFDGKMSLILNVAVGATNGYFQDSWHNTPHAKPWKNNSPTAMMDFWKSKQQWQSTWHGE-

H.discus SADFHTFGLDWSPDSMQWLLDDQVYHTESLQRNFWDGV----------------YNQNGSPFDKNFFIILNLAVGG--NFFGGEPFDPSESDGWAKN----------------------- C.antarcticus TTDFHVYKLTWSQSEIKMFIDDIQYMVFDITP--------------------------LPVFQKNFYVLLNLAVGG--NFPN--IHDAGAVTAPLPG----------------------- B.xylophilus L.sitkana T_molitor S.purpuratus H.armigera P.sachalinensis C.albidus M.yessoensis P.viridis H.discus C.antarcticus B.xylophilus Исследование влияния групп-специфических реагентов на активность эндо-13D-глюканазы GI позволило сделать некоторые заключения о роли отдельных функциональных групп. Как и для большинства 13--D-глюканаз различного типа действия, окисление аминокислотных остатков триптофана N-бромсукцинимидом в слабокислой среде приводило к полной потере активности эндо-13--D-глюканазы из L. sitkana. Эти данные согласуются с исследованием структуры фермента: остатки триптофана расположены в молекуле вблизи каталитического участка и участвуют в связывании субстрата. Ацетилимидазол, взаимодействующий с остатками тирозина и гистидина, вызывал 40 %-ое ингибирование фермента. Вероятно, модификация затрагивает важный остаток тирозина, так как реагент на гистидин, диэтилпирокарбонат, почти не влиял на активность фермента. Реагент на SH–группу, N-этилмалеимид, не понижал активность эндо-13--D-глюканазы из L. sitkana.

Вероятно, в молекуле глюканазы нет свободной SH-группы, принимающей участие в каталитическом акте.

2 Сравнительный анализ каталитических свойств эндо-13--D-глюканаз, выделенных из L. sitkana и P. sachalinensis Сравнительные исследования особенностей реакции трансгликозилирования, протекающей одновременно с гидролизом ламинарана, проведены для близких по специфичности эндо-13--D-глюканаз GI из L. sitkana и LIV из Р. sachalinensis.

Ферментативные реакции проводились с использованием глицерина в качестве акцептора. Продукты реакций гидролиза и трансгликозилирования ферментами GI и LIV на различных стадиях анализировали методами – МАЛДИ и ИЭР МС, а также методом ВЭЖХ. Согласно данным масс-спектрометрии, при гидролизе ламинарана под действием фермента GI накапливались, главным образом, олигосахариды, состоящие из 3, 4 или 5 остатков глюкозы. В случае гидролиза глюканазой LIV накапливались преимущественно олигосахариды со степенью полимеризации 3–7. С первых минут реакции гидролиза обоими ферментами в продуктах появлялась глюкоза. Масс-спектрометрические данные качественного состава продуктов полностью согласовывались с результатами, полученными методом ВЭЖХ.

Идентифицированы продукты гидролиза ламинарана глюканазой GI: Glc – 44 %, Glc – 17,2 %, Glc3 – 22,2 %, Glc4 – 9,0 %, Glc5 – 7,6 %, и продукты гидролиза глюканазой LIV: Glc – 27,2 %, Glc2 – 26,8 %, Glc3 – 26,0 %, Glc4 – 10,8 %, Glc5 – 9,2 %.

Методом ИЭР МС исследовали кинетику реакций гидролиза и трансгликозилирования, одновременно катализируемых глюканазами GI и LIV. В качестве акцептора использовали глицерин в концентрации 0,1, 0,5 и 1 М. В массспектрах (рис. 6) присутствовали следующие сигналы продуктов гидролиза: [Glc+Na]+ с m/z 203,01, [Glc2+Na]+ с m/z 365,11, [Glc3+Na]+ с m/z 527,17, [Glc4+Na]+ с m/z 689,23, [Glc5+Na]+ с m/z 851,28, [Glc6+Na]+ с m/z 1013,34, [Glc7+Na]+ с m/z 1175,4, [Glc8+Na]+ с m/z 1337,46, и трансгликозилирования: [GlyGlc+Na]+ с m/z 277,1, [GlyGlc2+Na]+ с m/z 439,4, [GlyGlc3+Na]+ с m/z 601,6, [GlyGlc4+Na]+ с m/z 763,8, [GlyGlc5 +Na]+ с m/z 925,4, [GlyGlc6+Na]+ с m/z 1088,1, [GlyGlc7+Na]+ с m/z 1250,3, [GlyGlc8 +Na]+ с m/z 1412,4. При действии глюканазы LIV скорость гидролиза была выше, чем скорость реакции трансгликозилирования (рис. 6 А). При действии глюканазы GI, напротив, реакция трансгликозилирования протекала более эффективно (рис. 6 Б). Скорость гидролиза у GI была преобладающей лишь на начальных стадиях реакции при небольших концентрациях глицерина.

Рисунок 6 – ИЭР масс-спектры продуктов реакций гидролиза и трансгликозилирования, катализируемых эндо-13--D-глюканазами GI (А) и LIV (Б), с использованием ламинарана (5 мг/мл) в качестве донора и глицерина (1,0 М для GI и 0,5 М для LIV) в качестве акцептора Из масс-спектров продуктов гидролиза и трансгликозилирования, образовавшихся на начальных стадиях реакции, были рассчитаны суммарные интенсивности сигналов. Для расчета использовали интенсивности сигналов ионов глюкозы и олигосахаридов или олигозидов со степенью полимеризации 2-5, полученных при концентрациях глицерина 0,1, 0,5 и 1 М. Значения суммарной интенсивности сигналов продуктов представлены в виде графиков на рисунке 7. На графиках видно, что для фермента GI продукты реакции трансгликозилирования продолжали накапливаться до концентрации глицерина 1 М (рис. 7 А), в то время, как количество продуктов гидролиза резко падало уже при концентрации глицерина 0, М. Количество продуктов реакции трансгликозилирования для LIV возрастало с увеличением концентрации глицерина до 0,5 М. Количество продуктов гидролиза уменьшалось при концентрации глицерина выше 0,5 М (рис.7 Б).

Рисунок 7 – Продукты трансгликозилирования (пунктир) и гидролиза (сплошная линия) ламинарана, полученные при действии эндо-13--D-глюканаз GI (А) и LIV (Б) трансгликозилирования, катализируемых LIV, позволил нам сделать предположение, что фермент частично инактивируется в интервале концентраций глицерина 0,5–1 М.

Исследование свойств GI показало, что фермент обладает более высокой способностью катализировать реакцию трансгликозилирования, чем гидролиза. По всей видимости, акцепторный участок GI обладает большим сродством к глицерину, чем к воде. Накопление продуктов реакции гидролиза в присутствии глицерина, измеренное методом Нельсона (регистрация продуктов по содержанию восстанавливающих сахаров), подтвердило полученные выше данные: продукты гидролиза практически не образовывались в присутствии глицерина в концентрации 0,1 М.

Отношение констант скорости реакций трансгликозилирования kтранс (перенос на глицерин) и гидролиза kгидр (перенос на воду) было рассчитано на основе массспектрометрических данных:

 = kтранс/kгидр = Iтранс/Iгидр  [H2O]/[Глицерин]  где Iтранс и Iгидр максимальные суммарные интенсивности продуктов гидролиза и трансгликозилирования. Для LIV значения Iтранс и Iгидр оказались максимальными при концентрации глицерина 0,5 M = 80. Для GI = 225 при концентрации глицерина M. Полученное нами значение для LIV оказалось близким к значениям, рассчитанным ранее другими методами.

3 -D-Глюкозидаза GII из L. sitkana В печени моллюска L. sitkana было обнаружено несколько гликозидаз различной специфичности. Наше внимание привлекла -D-глюкозидаза GII, обладающая необычной для гликозидаз (олигосахаридгидролаз) способностью к гидролизу полимерного субстрата – ламинарана. Фермент с удельной активностью 2,4±0.1 ед/мг был выделен с выходом 0,9 % согласно схеме, представленной в таблице 4.

Таблица 4 – Схема выделения -D-глюкозидазы GII из печени L. sitkana Хроматография на ДЭАЭ-целлюлозе Рехроматография на ДЭАЭ-целлюлозе Гельфильтрация на * n-нитрофенил--D-глюкопиранозид в качестве субстрата Молекулярная масса GII, согласно данным ДСН-электрофореза составила 200 кДа (рис. 8). -D-Глюкозидаза GII проявляла наибольшую активность при значении рН 5,4, что практически не отличалось от значения рН, полученного для GI. Температурная стабильность GII была ниже, чем у GI: фермент быстро терял свою субстратах, характеристика которых представлена в табице 2.

Показано, что фермент с высокой скоростью гидролизовал низкомолекулярный субстрат – n-нитрофенил -D-глюкопиранозид.

Фермент не действовал на периодатно-окисленный ламинаран, незначительно гидролизовал лихенан (0,06 %).

Рисунок 8 – 10 % ДСН-электрофорез -D-глюкозидазы из L. sitkana:

(1) -D-глюкозидаза, (2) белковые маркеры Методами поляриметрии и 13С ЯМР спектроскопии исследован механизм реакции гидролиза ламинарана ферментом GII. Согласно поляриметрическим данным, процесс гидролиза происходит с сохранением конфигурации расщепляемой связи. 13С ЯМР спектры продуктов ферментативной реакции не отличались от спектров продуктов, полученных при исследовании GI (рис. 3).

Продукты реакции гидролиза ламинарана ферментом GII исследовали методами ВЭЖХ и МАЛДИ МС. В качестве продукта реакции идентифицировали глюкозу. В МАЛДИ масс-спектре присутствовал единственный сигнал с m/z = 203,01, который соответствовал иону [Glc+Na]+.

Проведены исследования каталитических свойств GII, характерных для -Dгликозидаз (КФ 3.2.1.21). Методом ВЭЖХ было показано, что скорость гидролиза ламинариолигосахаридов исследуемым ферментом уменьшалась с увеличением их степени полимеризации. GII обладал способностью гидролизовать -D-глюкобиозы с различным типом связи. Помимо -13-связей (ламинарибиоза) фермент гидролизовал -14- (целлобиоза) и -16-связи (гентиобиоза). Относительная скорость гидролиза этих дисахаридов составила 100 %, 24 % и 2 % соответственно.

Глюкозидаза GII также катализировала гидролиз гликозидов и малонилгликозидов изофлавоноидов из клеточной культуры высшего растения Maakia аmurensis.

Показана способность -D-глюкозидазы GII к трансгликозилированию. При исследовании этой реакции использовали ламинаран как донор и метил--Dглюкопиранозид как акцептор. Анализ МАЛДИ МС показал присутствие в продуктах реакции следующих ионов [Glc+Na]+ с m/z 203,0, [Glc2OMe+Na]+ с m/z 379,1 и [Glc3OMe+Na]+ с m/z 541,2, которые соответствуют продуктам трансгликозилирования – метилглюкобиозиду и метилглюкотриозиду.

На основании результатов исследования свойств и специфичности мы классифицировали GII как -D-глюкозид глюкогидролазу (КФ 3.2.1.21), обладающую необычной способностью катализировать гидролиз ламинарана.

4 Влияние эффекторов природного происхождения на активность ферментов GI и GII из морского моллюска L. sitkana Наличие ингибирующей активности у некоторых веществ объясняется сходством структуры этих соединений с природным субстратом фермента.

Субстратоподобные ингибиторы часто используют в исследованиях Огликозидгидролаз, в частности при установлении типа действия фермента. К таким соединениям относятся хорошо известные природные ингибиторы – кастаноспермин, нойримицин и глюконолактон. В дополнение к этим ингибиторам нами было исследовано влияние на активность ферментов моногалактодиацилглицерина – вещества, выделенного из бурой водоросли F. evanescens (табл. 6). Нойримицин и глюконолактон проявили ожидаемую для этих соединений активность: ингибировали -D-глюкозидазу со значением I50 25 и 50 мкМ соответственно. Действие этих веществ на эндо-13--D-глюканазу было на порядок менее эффективным: I50 для нойримицина составило 287 мкМ и для глюконолактона – 300 мкМ. Кастаноспермин, являющийся специфичным ингибитором глюкозидаз, не действовал на глюканазу GI.

Ингибирующее действие моногалактодиацилглицерина оказалось сходным с действием нойримицина и глюконолактона (таб. 5).

Таблица 5 – Влияние некоторых ингибиторов на активность эндо-13--D-глюканазы GI и -D-глюкозидазы GII из L. sitkana 5 Сульфатазы из L. sitkana и T. chrysostomus Проведен анализ содержания сульфатазной активности в пищеварительных органах некоторых видов морских моллюсков (11 видов двустворчатых и 2 вида брюхоногих), обитающих в бухте Троицы залива Посьета Японского моря.

Высокий уровень активности был обнаружен в печени брюхоногих моллюсков:

Tectonatica janthostoma и Littorina sitkana – он превышал активность сульфатаз двустворчатых моллюсков в 2–4 раза. Активность сульфатаз была также определена в 5 видах брюхоногих моллюсков, распространенных в Южно-Китайском море у побережья Республики Вьетнам. Низкий уровень активности фермента наблюдался только у хищного моллюска Conus rexilum, растительноядные виды содержали высокоактивные сульфатазы.

Для выделения и изучения свойств сульфатаз были выбраны брюхоногий моллюск L. sitkana, собранный на литорали Японского моря, и T. сhrysotomus, обитающий в береговой зоне республики Вьетнам (Ю-Китайское море).

5.1 Арилсульфатаза из морского моллюска L. sitkana Сульфатаза из печени L. sitkana была выделена с помощью методов осаждения (NH4)2SO4, ультрафильтрацией, ионообменной хроматографией на КМ-целлюлозе и гель-фильтрацией на Sepharose CL-6B. Молекулярная масса фермента согласно данным ДСН-электофореза в полиакриламидном геле составила 45±1 кДа. Значение Кm гидролиза n-нитрофенилсульфата калия было равным 8,7±1 мМ. Оптимальное значение рН фермента, при котором изучались его свойства, был равен 5,4. Время полуинактивации фермента при 60 °С составило 20 мин, а полная потеря активности наблюдалась при 70 °С за то же время.

Специфичность фермента исследовали на природных сульфатированных соединениях различной структуры. Согласно данным 13С ЯМР спектроскопии и электрофореза сульфатаза не действовала на фукоидан из F. evanescens и на сульфатированные производные фукозы. Ингибирующей способностью по отношению к сульфатазе эти соединения не обладали. Для изучения специфичности сульфатазы также использовали сульфатированные полиоксистероиды и их гликозиды, богатая коллекция которых была предоставлена Лабораторией химии природных соединений ТИБОХ ДВО РАН. Прежде, чем использовать эти вещества в качестве субстратов, было изучено их ингибирующее действие по отношению к сульфатазе. Исследование действия 17 соединений на активность сульфатазы из L.

sitkana в присутствии субстрата, n-нитрофенилсульфата, показало, что наиболее сильным ингибирующим действием (I50~10-5 M) на фермент обладали стероидные дисульфаты, подобные тем, что встречаются в офиурах. Астеросапонины, содержащие сульфаты в агликоновой части молекулы, обладали слабым ингибирующим действием (I50~10-3 М). Сульфатаза из L. sitkana не катализировала десульфатирование полиоксистероидов, имеющих сульфатную группу в стероидном ядре, а также гликозида № 3, сульфатированный остаток 3-О-Ме-ксилозы которого расположен в боковой цепи (табл. 6, рис. 9).

Таблица 6 – Специфичность действия сульфатазы из L. sitkana и влияние природных гликозидов в концентрации 0,05-1 мг/мл на активность фермента * - в качестве субстратов вещества использовали в концентрациях ниже I Рисунок 9 – Структура природных гликозидов. Номера формул соответствуют названиям соединений, приведённым в таблице Тритерпеновые гликозиды голостанового ряда (№ 5–7) (табл. 6, рис. 9), ингибировали сульфатазу со значениями I50~10-4 М. Реакцию ферментативного десульфатирования этих веществ проводили в растворах, где их концентрация была ниже величины I50. Показано, что сульфатаза обладала десульфатирующей активностью по отношению к исследуемым гликозидам. В качестве продуктов реакции были получены десульфатированные производные этих соединений с выходом около 50 %. Структуру десульфатированных гликозидов подтверждали данными 13С ЯМР спектроскопии. Сравнение 13С ЯМР спектров нативных тритерпеновых гликозидов и обработанных сульфатазой показало, что фермент катализировал отщепление сульфатной группы от С4 остатка ксилозы. Согласно свойствам и специфичности сульфатаза из L. sitkana была отнесена к арилсульфатазам (КФ 3.1.6.1).

5.2 Арилсульфатаза из морского моллюска T. chrysostomus Из печени моллюска T. chrysotomus нами была выделена сульфатаза, эффективно катализирующая расщепление n-нитрофенилсульфата калия. Схема выделения сульфатазы включала комбинацию методов осаждения (NH4)2SO4, ультрафильтрации, гидрофобной хроматографии на колонке с Phenyl-sepharose и ионообменной хроматографии на Econo Pac Q. Сульфатаза была получена со степенью очистки в 300 раз и не содержала сопутствующих О-гликозидгидролаз.

Удельная активность фермента составила 7,2102 ед/мг.

Наибольшую активность при действии на n-нитрофенилсульфат сульфатаза из T. chrysostomus проявляла при значении рН 7. Согласно данным гель-фильтрации молекулярная масса сульфатазы была равна 35 кДа. Значение Кm гидролиза nнитрофенилсульфата составило 10 мМ. Фермент был относительно термостабильным. Время его полуинактивации при 60 °С составило 30 мин.

сульфатированных соединений из морских источников, предоставленной Лабораторией химии природных соединений ТИБОХ ДВО РАН. Анализ продуктов реакции методом электрофореза показал, что сульфатаза из T. chrysostomus не катализировала десульфатирование полимерных субстратов, декстран сульфата и фукоидана из бурой водоросли F. еvanescens. По данным масс-спектрометрии сульфатаза также не действовала на фукозу, сульфатированную в С4 положении.

Ингибирующим действием эти вещества не обладали.

Влияние тритерпеновых гликозидов и сульфатированных полиоксистероидов на активность сульфатазы из T. сhrysostomus исследовали с использованием в качестве субстрата n-нитрофенилсульфат калия (табл. 7, рис. 10). Установлено, что гликозиды (№ 12, 14, 15), сульфатированные по агликону, ингибировали активность сульфатазы со значением I50~10-8 М. Ингибитором сульфатазы также являлся астеросапонин № 11, который содержал сульфатную группу в моносахаридном остатке. Отсутствие ингибирующего действия гликозида № 13 в сравнении с другими гликозидами морских звёзд может быть связано с наличием в его молекуле более протяженной углеводной цепи, представленной гексасахаридным фрагментом. Гликозиды голотурий увеличивали активность сульфатазы на 50 % в интервале концентраций 3,510-10– 810-10 М. Исключение составлял голотурин А (№ 1), который не влиял на активность фермента. Особенностью структуры этого вещества является наличие в полициклической системе дополнительных эпоксидной группы и ОН-групп.

Действие сульфатазы на сульфатированные природные гликозиды (табл. 7, рис.

10) из морских звёзд и голотурий оценивали с помощью тонкослойной хроматографии, используя в качестве стандартов соответствующие десульфатированные гликозиды. Результаты эксперимента показали, что действию сульфатазы не подвергались гликозиды морских звёзд (№ 12–15) и астеросапонин (№ 11), имеющий сульфатную группу в остатке 3-О-Ме-ксилозы, расположенном в боковой цепи. Фермент катализировал отщепление сульфатной группы, находящейся при С4 первого моносахаридного остатка ксилозы в углеводной цепи тритерпеновых гликозидов голотурий: голостанового (№ 1–7), ланостанового (№ 10) и норланостанового (№ 9) рядов. Десульфатирование голотурина (№ 1) сульфатазой из T. chrysostomus дополнительно подтверждено методом ВЭЖХ, а псевдостихопозида В (№ 3) – методом масс-спектрометрии.

Таблица 7 – Специфичность действия сульфатазы из T. chrysostomus и влияние природных гликозидов в концентрации 0,05-1 мг/мл на активность фермента (+) – наличие десульфатирования Рисунок 10 – Структура природных гликозидов. Номера формул соответствуют названиям соединений, приведённым в таблице Таким образом, из морского моллюска T. chrysostomus выделена новая арилсульфатаза (КФ 3.1.6.1), определены некоторые её свойства, установлена специфичность действия. Фермент катализировал отщепление сульфатной группы в положении С4 остатка ксилозы, входящего в состав углеводных цепей тритерпеновых гликозидов голостанового, ланостанового и норланостанового рядов.

5.3 Сравнение каталитических свойств сульфатаз, выделенных из L. sitkana и T. chrysostomus Сульфатазы, выделенные из брюхоногих моллюсков L. sitkana и T. chrysostomus, обладали высокой термостабильностью и имели близкие значения молекулярных масс и Km. Однако рН-оптимумы этих ферментов значительно различались: 5,4 – для сульфатазы из L. sitkana и 7 – для сульфатазы из T. chrysostomus. Интересные результаты были получены при изучении специфичности этих ферментов. Оба фермента оказались неактивными по отношению к фукоидану из бурой водоросли F. evanescens и к сульфатированным производным фукозы. Исследования сульфатированных природных гликозидов в качестве субстратов показали, что сульфатазы из морских моллюсков L. sitkana и T.

chrysostomus обладают специфичностью к сульфатной группе в положении С остатка ксилозы, входящего в состав углеводных цепей гликозидов голостанового ряда.

Несмотря на сходство в специфичности исследуемых сульфатаз, влияние природных полиоксистероидов на их активность существенно различалось. Значения I50 для сульфатированных полиоксистероидов и их гликозидов варьировало от 10-3 до 10-8 М по отношению к изучаемым сульфатазам. Тритерпеновые гликозиды голотурий не оказывали ингибирующего действия на активность сульфатазы из T. chrysostomus.

Для этого фермента также необычным явилось то, что халистанолсульфат и некоторые гликозиды в концентрациях (~10-10 М) увеличивали активность фермента.

6 Тирозилпротеин сульфотрансфераза из L. sitkana Тирозилпротеин сульфотрансферазы, катализирующие сульфатирование остатков тирозина в белках и пептидах, найдены у многих видов позвоночных.

Известно, что все млекопитающие содержат две изоформы фермента, ТПСТ-1 и ТПСТ-2, которые являются трансмембранными белками, ассоциированными с аппаратом Гольджи. Аминокислотные последовательности ТПСТ животных имеют высокую степень гомологии. Используя различные базы генетических данных, мы нашли частичные последовательности мРНК и ДНК, кодирующие ТПСТ, в четырёх видах морских моллюсков: головоногом Idiosepius paradoxus, брюхоногих Crepidula fornicate и Lottia gigantean и двустворчатом Crassostrea gigas. Геном последнего недавно был секвенирован и содержал ген, кодирующий ТПСТ, структурно близкий к изоформе ТПСТ-2.

Поскольку информация о выделении ТПСТ из морских моллюсков отсутствует, нами были опробованы три способа экстракции мембранных белков (рис. 11).

Подготовку одного из экстрактов проводили в градиенте сахарозы. Экстракцию двумя другими способами проводили буфером А (50 мM Трис-HCl, pH 6,8, с содержанием 4 % ДСН, 3 % 2-меркаптоэтанола, 20 % глицерина и бромфенолового синего) и буфером Б (50 мM Трис-HCl, pH 7,4, с содержанием 1 % NP-40, 0,25 % дезоксихолата натрия, 1 мM ЭДТА, 1 мM PMSF, 1 мM NaF, ингибиторов протеаз, 20 мкл/мл) с последующим осаждением ацетоном. Последний способ экстракции был выбран для поиска ТПСТ в морских беспозвоночных методом Вестерн-блота. Поиск ТПСТ в видах беспозвоночных Атлантического побережья Франции был проведён с использованием поликлональных мышинных антител к ТПСТ-1. Присутствие ТПСТ было зафиксировано в экстрактах печени моллюска Mytilus edulis и глаз креветки Pandalus sp. в виде белковых полос в области 50 кДа, а также в экстракте печени моллюска Mercenaria sp. в виде полосы белка – 60 кДа (рис. 11, 12).

Рисунок 11 – Вестерн-блот экстрактов печени двустворчатых моллюсков C. gigas (2, 5, 8) и M.

edulis (3, 6, 9) и печени мыши (4, 7, 10), с использованием антител к ТПСТ-1, где 1 – маркеры; 2, 3, 4 – экстракция в градиенте сахарозы; 5, 6, 7 – экстракция буфером А; 8, 9, 10 – экстракция буфером Б Полученные результаты позволяют сделать вывод о наличии ТПСТ в некоторых видах морских беспозвоночных, однако не исключено, что этот фермент присутствует и в других видах.

С целью установления первичной структуры фермента был проведён поиск гена, кодирующего ТПСТ, в геноме морского моллюска L. sitkana. Амплификацию кДНК методом ПЦР проводили с использованием вырожденных олигонуклеотидных праймеров, которые были созданы на консервативные участки аминокислотных последовательностей ТПСТ человека и некоторых видов морских моллюсков.

Методом быстрой амплификации кДНК концов (RACE метод) установлена полная последовательность кДНК, кодирующей ТПСТ L. sitkana. Анализ этой последовательности показал, что кДНК содержит одну протяжённую рамку считывания длиной 1224 п.н., которая кодирует белок, состоящий из 407 а.о.

Расчётная молекулярная масса белка без посттрансляционных модификаций составляет 46,63 кДа, изоэлектрическая точка – 8,94.

Сравнение аминокислотной последовательности ТПСТ из L. sitkana с последовательностями двух изоформ ТПСТ человека и некоторых видов беспозвоночных выявило высокую степень структурной гомологии – 70–85 %.

Наибольшая степень гомологии наблюдалась с белком из С. gigas (85 %), гомология с ТПСТ позвоночных составила 74–81 %. Степень идентичности аминокислотной последовательности ТПСТ из L. sitkana и аминокислотной последовательности брюхоногого моллюска C. fornicate составила 85 %.

С помощью сервера InterProScan показано, что участок ТПСТ из L. sitkana с по 355 а.о. соответствует каталитическому домену ТПСТ-2. Множественное выравнивание аминокислотных последовательностей ТПСТ-1 и ТПСТ-2 человека и некоторых беспозвоночных: насекомых Drosophila melanogaster и Culex quinquefasciatus, двустворчатого моллюска C. gigas, нематоды Caenorhabditis elegans и асцидии Halocynthia roretzi, представлено на рисунке 13.

TPST2_HUMAN (O60704) ------MRLSVRRVLLAAGCALVLVLAVQLGQQVLECRAVLAGLRSPRGA TPST1_HUMAN (O60507) ------MVGKLKQNLLLACLVISSVTVFYLGQHAMECHHRIEERSQPVKL D.melanogaster (AAM94031) ---MRLPYRNKKVTLWVLFGIIVITMFLFKFTELRPTCLFKVDAANELSS C.quinquefasciatus(EDS40555) -------MRNRKIVLGVAGAAILLLMVFFKGTELGARCLANGGGS---VG C.elegans (O77081) -------MRKNRELLLVLFLVVFILFYFITARTADDPYYSNHREK--FNG C.gigas (EKC35269) -------------------------------------------------H.roretzi (AAM09087) MGLGTAGIGGVKRIWWISLWLLTIYFTYLYSSGYPKEGKMGTSFINRDIM

TPST2_HUMAN MRPEQEELVMVGTN----HVEYRYGKAMPLIFVGGVPRSGTTLMRAMLDA

TPST1_HUMAN ESTRTTVRTGLDLKA---NKTFAYHKDMPLIFIGGVPRSGTTLMRAMLDA

QMVRVEKYLTDDNQ-----RVYSYNREMPLIFIGGVPRSGTTLMRAMLDA

AAADDGDESLPFHQLTSVRSDDGYNRTSPFIFIGGVPRSGTTLMRAMLDA

L.sitkana                                                        IMVPKEKNHFIYDSKN---RAIPYGEDMEIIFVGGMPRSGTTLMRVMLDA

MVKNSQEYQYNSVDQK--PTLVKNDQDMPLIFIGGMPRSGTTLMRTMLDA

TPST2_HUMAN HPEVRCGEETRIIPRVLAMRQAWSKSGREKLRLDEAGVTDEVLDAAMQAF

TPST1_HUMAN HPDIRCGEETRVIPRILALKQMWSRSSKEKIRLDEAGVTDEVLDSAMQAF

HPDVRCGQETRVIPRILQLRSHWLKSEKESLRLQEAGITKEVMNSAIAQF

HPEVRCGEETRVIPRILNLRSQWKKSEKEWNRLQQAGVTGEVINNAISSF

HPDVRCGEETRVIPRILGLRTQWEKSAMEKKRLEAAGVTGEVLDSAVRAF

HPEVRCGEETRVIPRILGMRNHWQKSEIERKRLVEAGINDAVIDSAVSAF

HPDVRCGQETRVIPRLLFMRNNWIRSVKERRRLEEAGILPKVLDQAVSQF

TPST2_HUMAN ILEVIAKHGEPARVLCNKDPFTLKSSVYLSRLFPNSKFLLMVRDGRASVH

TPST1_HUMAN LLEIIVKHGEPAPYLCNKDPFALKSLTYLSRLFPNAKFLLMVRDGRASVH

CLEIIAKHGEPAPRLCNKDPLTLKMGSYVIELFPNAKFLFMVRDGRATVH

IMEIMVGHGDRAPRLCNKDPFTMKSAVYLKELFPNAKYLLMIRDGRATVN

ILEVVAKHGEAAPRLCNKDPFTLKSAIYLSHQFPRSRFIFMIRDGRAVVH

ILEIIAKHGDAAPRLCNKDPFTLKSSQYLSSLFPNAKFILMIRDGRAVIH

ILEIIINHGSAAKFLCNKDPFTLKATTYLHELFPNAKFILMLRDGRATAH

TPST2_HUMAN SMITRKVTIAGFDLSSYRDCLTKWNKAIEVMYAQCMEVGKEKCLPVYYEQ

TPST1_HUMAN SMISRKVTIAGFDLNSYRDCLTKWNRAIETMYNQCMEVGYKKCMLVHYEQ

SIISRKVTITGFDLSSYRQCMQKWNHAIEVMHEQCRDIGKDRCMMVYYEQ

SIISRKVTITGFDLNDFRQCMTKWNAAIQIMVDQCESVGEKNCLKVYYEQ

SIITRKVTISGFDLKSYRNCLQKWSSAMENMYSQCLRVGPSRCMPVYYEQ

SVISRKVTISGFDLKNPKMCLEKWNTAMEVMYSQCLRVGPMRCMPVYYEQ

SIISRKVTIAGFDITSYRDVLTKWNRALEVIHNQCNEVGSKYCLSVHYET

TPST2_HUMAN LVLHPRRSLKLILDFLGIAWSDAVLHHEDLIGKPGGVSLSKIERSTDQVI

TPST1_HUMAN LVLHPERWMRTLLKFLQIPWNHSVLHHEEMIGKAGGVSLSKVERSTDQVI

LVLHPEEWMRKILKFLDVPWNDAVLHHEEFINKPNGVPLSKVERSSDQVI

LVLHPEAQMRRITEFLDIPWDDKVLHHEQLIGKD--ISLSNVERSSDQVV

LALHPREWMMKIVKFLDLPWNETVLHHEDFIG--DKISLSRTEKSTDQVI

LALHPEVWMHRILEFLDIPWNNSVLHHEDFIGKPGGASLSKTEKSTDQVI

LVLRPVQETKRIFTFLDIPWSDHVLHHEKYLP---DIQLSKLEKSTDQVQ

TPST2_HUMAN KPVNLEALSKWTGHIPGDVVRDMAQIAPMLAQLGYDPYANPPNYGNPDPF

TPST1_HUMAN KPVNVGALSKWVGKIPPDVLQDMAVIAPMLAKLGYDPYANPPNYGKPDPK

KPVNLEAMSKWVGQIPGDVVRDMADIAPMLSVLGYDPYANPPDYGKPDAW

KPVNLDALIKWVGTIPEDVVADMDSVAPMLRRLGYDPNANPPNYGKPDEL

KPVNVEALSKWVGNIPDDVVKDMHTIAPMLMTLGYDPHANPPNYGKPDAQ

KPVNIEALSKWVGFYSDEIIADMAKIAPMLQTLGYDPDKNPPDYGKPDPK

RPLYLDALTSWFGHIPEDVERDMAKIAPMLTKLGYDPSIQRPSYGEPDEF

Рисунок 13 – Множественное выравнивание аминокислотных последовательностей ТПСТ человека и некоторых видов беспозвоночных. В скобках указаны номера последовательностей в базе данных GenBank. Черным цветом выделены идентичные а.о., серым цветом – гомологичные а.о. Подчёркивание – трансмембранный участок; (*) отмечен участок связывания ФАФС; () – каталитические а.о.; () – а.о. субстрат-связывающего участка; () – а.о., участвующие в стабилизации фермента во время катализа. Все а.о., участвующие в катализе, отмечены для ТПСТ-2 человека Анализ множественного выравнивания показал, что консервативной является последовательность PRSGTTLM, остатки аминокислот которой входят в участок связывания с ФАФС. Мембранный участок с 12 по 30 а.о. определён с помощью сервера InterProScan и совпадает с трансмембранными участками ТПСТ других животных. Показано также, что ТПСТ из L. sitkana содержит шесть остатков цистеина (С31, С90, С150, С204, С219, С227) (здесь и далее а.о. нумерованы для ТПСТ из L.

sitkana), которые являются консервативными и участвуют в образовании трёх дисульфидных связей, вероятно необходимых для стабилизации молекулы. На основе данных мутационного анализа, полученных для ТПСТ-2 человека, было показано, что консервативные остатки R72 и E93 принимают непосредственное участие в катализе, а K152 и S277, также являясь консервативными, необходимы для стабилизации переходного состояния фермента. Положительно заряженные консервативные остатки: R95, R99, R116, К158, К109, гомологичная замена R276, а также остаток Т192, согласно данным направленного мутагенеза ТПСТ-2 человека, входят в субстрат-связывающий участок, где взаимодействуют с кислыми аминокислотными остатками молекулы акцептора. Во всех ТПСТ животных участок от трансмембранного до каталитического домена отличается низкой степенью гомологии, и его часто называют неструктурированным. Имеются предположения, что этот участок совместно с некоторыми консервативными а.о. каталитического домена играет роль в формировании специфичности фермента.

ВЫВОДЫ

1. Выделена новая эндо-13--D-глюканаза GI (КФ 3.2.1.39) из печени Littorina sitkana с молекулярной массой 39,3 кДа. Фермент проявлял наибольшую активность при рН 5,4 и 40 оС, Кm гидролиза ламинарана – 0,13 мг/мл. Показано, что GI катализирует гидролиз -13-связи в глюканах и осуществляет синтез как -13-, так и -14-гликозидных связей. Установлена первичная структура GI.

2. Изучена кинетика одновременного протекания реакций гидролиза и трансгликозилирования, катализируемых эндо-13--D-глюканазами из L. sitkana и Pseudocardium sachalinensis (LIV) методами масс-спектрометрии и ВЭЖХ. Глюканаза GI (=225) обладала более высокой способностью к реакции трансгликозилирования, чем LIV (=80).

Выделена новая -D-глюкозидаза GII (КФ 3.2.1.21) из печени L. sitkana с молекулярной массой 200 кДа. Показано, что фермент обладает необычной для гликозидаз способностью катализировать гидролиз ламинарана (Кm – 0,34 мг/мл).

Глюкозидаза предпочтительно катализировала гидролиз -13-гликозидных связей, скорость гидролиза глюкозидазой -14- и -16-связей была соответственно в 4 и 50 раз меньше, чем -13-связи. Фермент GII проявлял трансгликозилирующую активность.

4. Исследовано влияние некоторых природных ингибиторов на активность ферментов GI и GII из L. sitkana. Показано, что моногалактодиацилглицерин из Fucus evanescens ингибировал -D-глюкозидазу более эффективно (I50=75 мкМ), чем эндоD-глюканазу (I50=280 мкМ).

5. Выделены новые арилсульфатазы из L. sitkana и Turbo chrysostomus, катализирующие гидролиз n-нитрофенилсульфата со значениями Кm 8,7 и 10 мМ соответственно. Ферменты сохраняли свою активность при 60 оС. Показано, что гликозиды морских звёзд, содержащие сульфатные группы в агликоновой части молекулы, ингибировали активность арилсульфатаз. Некоторые гликозиды голотурий в интервале концентраций 3,510-8–10-10 М увеличивали активность фермента из L.

sitkana на 50 %.

6. Арилсульфатазы из L. sitkana и T. chrysostomus катализировали гидролиз сульфатной группы в положении С4 остатка ксилозы, входящей в состав углеводных цепей гликозидов голостанового ряда. Ферменты неактивны по отношению к фукоидану из F. evanescens и к сульфатированным производным фукозы.

7. В морских моллюсках проведён поиск тирозилпротеин сульфотрансфераз с использованием Вестерн-блота. Впервые установлена аминокислотная последовательность ТПСТ в моллюске L. sitkana. Проведена идентификация аминокислот, участвующих в связывании фермента с субстратами.

1. Кусайкин М.И., Песенцева М.С., Сильченко А.С., Авилов С.А., Сова В.В., Звягинцева Т.Н., Стоник В.А. Арилсульфатаза с необычной специфичностью из печени морского моллюска Littorina kurila // Биоорган. химия. – 2006. – Т. 32. С.

2. Pesentseva M.S., Kusaykin M.I., Anastyuk S.D., Sova V.V., Zvyagintseva T.N.

Catalytic properties and mode of action of endo-(13)--D-glucanase and -Dglucosidase from marine mollusk Littorina kurila // Carbohydr. Res. – 2008. – Vol. 343.

– P. 2393–2400.

3. Песенцева М.С., Сова В.В., Сильченко Александра С., Кича А.А., Сильченко Артём С., Haertl T., Звягинцева Т.Н.. Новая арилсульфатаза из морского моллюска Turbo chrysostomus // Химия природ. соедин. – 2012. – Т. 48. – С. 853– 4. Pesentseva M. S., Kovalchuk S.N., Anastyuk S.D., Kusaykin M.I., Sova V.V., Rasskazov V.A., Zvyagintseva T.N. Endo-(13)--d-glucanase GI from marine mollusk Littorina sitkana: Amino acid sequence and ESIMS/MS-estimated features of transglycosylation and hydrolysis reactions in comparison to analogous enzyme LIV from Pseudocardium sachalinensis // J. Mol. Cat.B: Enzymatic. – 2012. – Vol. 75. – 5. Сова В.В., Песенцева М.С., Захаренко А.М., Ковальчук С.Н., Звягинцева Т.Н.

Гликозидазы морских организмов // Биохимия. – 2013. – Т. 78, вып. 7. С. 962–976.

6. Kusaykin M.I., Pesentseva M.S., Anastyuk S.D., Sova V.V., Zvyagintseva T.N.

Laminarinase from the gastropodean marine mollusk Littorina kurila // Book of abstracts 4th «European conference on marine natural products». France. – 2005. – 7. Pesentseva M.S., Kovalchuk S.N., Zvyagintseva T.N., Rasskazov V.A., Haertl T.

Amino acid sequence of tyrosylprotein sulfotransferase from the marine gastropod Littorina sitkana // «1st Symposium on Marine Enzymes and Polysaccharides», Vietnam. – 2012. – P. 57.

8. Pesentseva M.S., Zakharenko A.M., Kusaykin M.I., Sova V.V., Zvyagintseva T.N.

Features of passing transglycosylation and hydrolysis reactions of polysaccharides catalyzed by endo-1,3--D-glucanases from marine mollusks of Sea of Japan and South Chine Sea // «1st Symposium on Marine Enzymes and Polysaccharides», Vietnam. – 2012. – P. 25.

ФЕРМЕНТЫ МОРСКОГО МОЛЛЮСКА Littorina sitkana:

13--D-ГЛЮКАНАЗА, -D-ГЛЮКОЗИДАЗА, СУЛЬФАТАЗА

И ТИРОЗИЛПРОТЕИН СУЛЬФОТРАНСФЕРАЗА

Автореферат диссертации на соискание ученой степени Подписано в печать 25.07.2013 г. Формат 60х84 1/16.

690990, г. Владивосток, ул. Пушкинская, 10. 

 
Похожие работы:

«Охлупин Юрий Сергеевич ИССЛЕДОВАНИЕ ОБМЕНА И ДИФФУЗИИ КИСЛОРОДА В КОМПОЗИЦИОННЫХ МАТЕРИАЛАХ La0.8Sr0.2Fe0.7Ni0.3O3– – Ce0.9Gd0.1O1.95 МЕТОДОМ РЕЛАКСАЦИИ ЭЛЕКТРОПРОВОДНОСТИ 02.00.21 – химия твердого тела АВТОРЕФЕРАТ диссертации на соискание ученой степени кандидата химических наук Новосибирск — 2013 Работа выполнена в Федеральном государственном бюджетном учреждении науки Институте химии твердого тела и механохимии Сибирского отделения Российской академии наук Научный...»

«Май Тхи Тхань Хуен АМПЕРОМЕТРИЧЕСКИЕ БИОСЕНСОРЫ ДЛЯ ОПРЕДЕЛЕНИЯ НЕКОТОРЫХ МИКОТОКСИНОВ 02.00.02 – Аналитическая химия АВТОРЕФЕРАТ диссертации на соискание ученой степени кандидата химических наук Казань – 2013 2 Работа выполнена на кафедре аналитической химии Химического института им. А.М. Бутлерова федерального государственного автономного образовательного учреждения высшего профессионального образования Казанский (Приволжский) федеральный университет Научный руководитель :...»

«Дрожжин Олег Андреевич Новые сложные перовскитоподобные оксиды кобальта Специальность 02.00.04 - физическая химия 02.00.01 - неорганическая химия Автореферат диссертации на соискание ученой степени кандидата химических наук Черноголовка - 2009 Работа выполнена в Институте Проблем Химической Физики РАН, на химическом факультете Московского Государственного Университета им. М.В. Ломоносова. Научные руководители: доктор химических наук Добровольский Юрий Анатольевич, доктор...»

«Охлупин Юрий Сергеевич ИССЛЕДОВАНИЕ ОБМЕНА И ДИФФУЗИИ КИСЛОРОДА В КОМПОЗИЦИОННЫХ МАТЕРИАЛАХ La0.8Sr0.2Fe0.7Ni0.3O3– – Ce0.9Gd0.1O1.95 МЕТОДОМ РЕЛАКСАЦИИ ЭЛЕКТРОПРОВОДНОСТИ 02.00.21 – химия твердого тела АВТОРЕФЕРАТ диссертации на соискание ученой степени кандидата химических наук Новосибирск — 2011 Работа выполнена в Учреждении Российской академии наук Институте химии твердого тела и механохимии Сибирского отделения РАН доктор химических наук Научный руководитель : старший...»

«РУДЕНКО АНДРЕЙ ОЛЕГОВИЧ Лигандообменное сорбционное концентрирование на сверхсшитых полистиролах при ВЭЖХ определении антибиотиков, аминокислот и витаминов Специальность 02.00.02 – аналитическая химия АВТОРЕФЕРАТ диссертации на соискание учёной степени кандидата химических наук Санкт-Петербург 2011 Работа выполнена на кафедре органической химии химического факультета СанктПетербургского государственного университета. Научный руководитель : Доктор химических наук, профессор...»

«ЛИ ВИТАЛИЙ МОЕСЕЕВИЧ СИНТЕЗ АЗА-ДИАРИЛЭТИЛЕНОВ ДЛЯ МОЛЕКУЛЯРНЫХ ФОТОПЕРЕКЛЮЧАТЕЛЕЙ И ЛОГИЧЕСКИХ УСТРОЙСТВ 02.00.03 – органическая химия АВТОРЕФЕРАТ диссертации на соискание ученой степени кандидата химических наук Черноголовка – 2011 Работа выполнена в лаборатории органической и супрамолекулярной фотохимии отдела нанофотоники Института проблем химической физики РАН Научный руководитель : доктор химических наук Будыка Михаил Федорович Официальные оппоненты : доктор химических...»

«Давуди Миандех Муса Синтез спироциклических гексагидропиримидин-2-онов/тионов 02.00.03 – органическая химия АВТОРЕФЕРАТ диссертации на соискание ученой степени кандидата химических наук Москва 2009 Работа выполнена на кафедре органической химии Московской государственной академии тонкой химической технологии им. М.В. Ломоносова Научный руководитель : Доктор химических наук, профессор Шуталев Анатолий Дмитриевич Официальные оппоненты : Доктор химических наук, ведущий научный...»

«Цветков Дмитрий Сергеевич Термодинамика разупорядочения, электро- и массоперенос в перовскитоподобных оксидах GdBaCo2-xFexO6- (x=0, 0.2) 02.00.04 – физическая химия Автореферат диссертации на соискание ученой степени кандидата химических наук Екатеринбург – 2010 1 Работа выполнена на кафедре физической химии ГОУ ВПО “Уральский государственный университет им. А.М. Горького” Научный руководитель : кандидат химических наук, доцент Зуев А.Ю. Официальные оппоненты : доктор...»

«Савчук Сергей Александрович Новые методические подходы к контролю качества алкогольной продукции и к выявлению наркотических веществ в биологических средах хроматографическими и хромато-масс-спектрометрическими методами Специальность 02.00.02 – Аналитическая химия АВТОРЕФЕРАТ диссертации на соискание ученой степени доктора химических наук Санкт-Петербург 2012 г. Работа выполнена в лаборатории токсикологии Национального научного...»

«ЛУКОВА Галина Викторовна МЕТАЛЛОЦЕНЫ IVБ ГРУППЫ: ЭЛЕКТРОХИМИЧЕСКИЕ, ФОТОФИЗИЧЕСКИЕ И КООРДИНАЦИОННЫЕ СВОЙСТВА 02.00.04 – физическая химия Автореферат диссертации на соискание ученой степени доктора химических наук Москва – 2009 Работа выполнена в Учреждении Российской академии наук Институте проблем химической физики РАН доктор химических наук, академик РАН А.Е. Шилов Научный консультант : доктор химических наук, профессор Официальные оппоненты : МЕЛЬНИКОВ Михаил Яковлевич...»

«Авдеева Надежда Михайловна Пробоподготовка QuEChERS и дисперсионная жидкостно-жидкостная микроэкстракция при одновременном определении микотоксинов различных классов хроматографическими методами 02.00.02 – аналитическая химия АВТОРЕФЕРАТ диссертации на соискание ученой степени кандидата химических наук Саратов 2013 2 Работа выполнена на кафедре химии ФГБОУ ВПО Владимирский государственный университет имени Александра Григорьевича и Николая Григорьевича Столетовых доктор...»

«Неганова Маргарита Евгеньевна ПРОИЗВОДНЫЕ АЛКАЛОИДА СЕКУРИНИНА И ИЗОАЛАНТОЛАКТОНОВ В КАЧЕСТВЕ ПОТЕНЦИАЛЬНЫХ НЕЙРОПРОТЕКТОРОВ Специальность 02.00.10 – биоорганическая химия АВТОРЕФЕРАТ диссертации на соискание ученой степени кандидата химических наук Черноголовка 2012 Работа выполнена в лаборатории нейрохимии ФАВ Федерального государственного бюджетного учреждения науки Института физиологически активных веществ Российской академии наук. Научный руководитель : кандидат...»

«ШАПОВАЛОВА Оксана Вячеславовна Окислительная конверсия природного газа и биогаза в синтез-газ в объемных проницаемых матрицах 02.00.04 – физическая химия АВТОРЕФЕРАТ диссертации на соискание ученой степени кандидата химических наук Москва - 2014 Работа выполнена в Федеральном государственном бюджетном учреждении науки Институте химической физики им. Н.Н. Семенова Российской академии наук Научный руководитель : Арутюнов Владимир Сергеевич доктор химических наук, профессор ИХФ...»

«ФАДЕЕВ ~рей Геннадьевич МОЛЕКУЛЯРНАЯ ПОДВИЖНОСfЬ И ПЕРВАПОРАЦИОННЫЕ СВОЙСТВА ГРЕБНЕОБРАЗНЫХ ПОЛИМЕРОВ С ФТОРАЛКИЛЬНЫМИ БОКОВЫМИ ГРУППАМИ. 02.00.06 - Химия высокомолекулярных соединений АВТОРЕФЕРАТ диссертации на соискание ученой степени кандидата химических наук. Москва, 1995 г. www.sp-department.ru Рабоrа выполнена в лаборатории поJJИМерных мембран ИнСТИiуrа...»

«Подколзин Иван Владимирович МАСС-СПЕКТРОМЕТРИЯ С ИНДУКТИВНО СВЯЗАННОЙ ПЛАЗМОЙ И ДИСПЕРСИОННАЯ ЖИДКОСТНО-ЖИДКОСТНАЯ МИКРОЭКСТРАКЦИЯ НЕКОТОРЫХ РЕДКИХ ЭЛЕМЕНТОВ ПРИ ИДЕНТИФИКАЦИИ ПИЩЕВЫХ ПРОДУКТОВ 02.00.02 – аналитическая химия АВТОРЕФЕРАТ диссертации на соискание ученой степени кандидата химических наук Саратов 2013 2 Работа выполнена на кафедре химии Владимирского государственного университета имени Александра Григорьевича и Николая Григорьевича Столетовых Научный руководитель...»

«БЫЧКОВ Алексей Леонидович Механическая активация ферментативного гидролиза полимеров биомассы дрожжей 02.00.21 – химия твердого тела АВТОРЕФЕРАТ диссертации на соискание ученой степени кандидата химических наук Новосибирск – 2010 Работа выполнена в Учреждении Российской академии наук Институте химии твердого тела и механохимии Сибирского отделения РАН доктор химических наук, профессор Научный руководитель Ломовский Олег Иванович доктор химических наук, профессор Официальные...»

«Кондратенко Михаил Сергеевич Влияние полибензимидазолов на структуру трехфазной границы, протонную проводимость и механизмы деградации поверхности платины в активных слоях электродов фосфорнокислотных топливных элементов Специальности: 02.00.06 – высокомолекулярные соединения 02.00.05 – электрохимия АВТОРЕФЕРАТ диссертации на соискание ученой степени кандидата физико-математических наук Москва – 2013 Работа выполнена на кафедре физики полимеров и кристаллов физического...»

«КОЗЛОВСКИЙ Анатолий Анатольевич СВОБОДНОРАДИКАЛЬНЫЕ ПРОЦЕССЫ НИЗКОТЕМПЕРАТУРНОГО ХЛОРИРОВАНИЯ И ПОЛИМЕРИЗАЦИИ МОНОМЕРОВ. ОСОБЕННОСТИ КИНЕТИКИ ТВЕРДОФАЗНОГО ХЛОРИРОВАНИЯ 02.00.04 – физическая химия АВТОРЕФЕРАТ диссертации на соискание ученой степени кандидата химических наук Черноголовка – 2010 Работа выполнена в Учреждении Российской академии наук Институте проблем химической физики РАН доктор химических наук, профессор Научный руководитель : Михайлов Альфа Иванович доктор...»

«ГАДОМСКИЙ Святослав Ярославович ИЗУЧЕНИЕ ДИСПРОПОРЦИОНИРОВАНИЯ СЕМИХИНОННЫХ РАДИКАЛОВ ПО НЕСТАЦИОНАРНОЙ КИНЕТИКЕ ЦЕПНЫХ РЕАКЦИЙ ХИНОНИМИНОВ С ГИДРОХИНОНАМИ 02.00.04 - физическая химия Автореферат диссертации на соискание ученой степени кандидата химических наук Черноголовка – 2010 Работа выполнена в Институте проблем химической физики РАН Научный руководитель : доктор химических наук Варламов Владимир Трофимович Официальные оппоненты : доктор химических наук Касаикина Ольга...»

«Фесенко Анастасия Андреевна СИНТЕЗ 2,5-ДИФУНКЦИОНАЛЬНО ЗАМЕЩЕННЫХ ГИДРИРОВАННЫХ ПИРИМИДИНОВ И РОДСТВЕННЫХ СОЕДИНЕНИЙ 02.00.03 – органическая химия АВТОРЕФЕРАТ диссертации на соискание ученой степени кандидата химических наук Москва, 2007 Работа выполнена на кафедре органической химии Московской государственной академии тонкой химической технологии им. М.В. Ломоносова Научный руководитель : Доктор химических наук, профессор Шуталев Анатолий Дмитриевич Официальные оппоненты :...»






 
© 2013 www.diss.seluk.ru - «Бесплатная электронная библиотека - Авторефераты, Диссертации, Монографии, Методички, учебные программы»

Материалы этого сайта размещены для ознакомления, все права принадлежат их авторам.
Если Вы не согласны с тем, что Ваш материал размещён на этом сайте, пожалуйста, напишите нам, мы в течении 1-2 рабочих дней удалим его.